![]() |
|
|
Vol. 12, Issue 5, 1293-1301, May 2001
Chain to Late Endocytic Compartments
Unité de Biologie des Interactions Cellulaires, Unité de Recherche Associée Centre National de la Recherche Scientifique 1960, Institut Pasteur, 75724 Paris Cedex 15, France
Submitted December 12, 2000; Revised December 27, 2000; Accepted February 12, 2001| |
ABSTRACT |
|---|
|
|
|---|
Down-regulation of cell surface growth factor receptors plays a key
role in the tight control of cellular responses. Recent reports suggest
that the ubiquitin system, in addition to participating in degradation
by the proteasome of cytosolic and nuclear proteins, might also be
involved in the down-regulation of various membrane receptors. We have
previously characterized a signal in the cytosolic part of the
interleukin 2 receptor
chain (IL2R
) responsible for its
targeting to late endosomes/lysosomes. In this report, the role of the
ubiquitin/proteasome system on the intracellular fate of IL2R
was
investigated. Inactivation of the cellular ubiquitination machinery in
ts20 cells, which express a thermolabile ubiquitin-activating enzyme
E1, leads to a significant decrease in the degradation rate of IL2R
,
with little effect on its internalization. In addition, we show that a
fraction of IL2R
can be monoubiquitinated. Furthermore, mutation of
the lysine residues of the cytosolic region of a chimeric receptor
carrying the IL2R
targeting signal resulted in a decreased degradation rate. When cells expressing IL2R
were treated either by
proteasome or lysosome inhibitors, a significant decrease in receptor
degradation was observed. Our data show that ubiquitination is required
for the sorting of IL2R
toward degradation. They also indicate that
impairment of proteasome function might more generally affect
intracellular routing.
| |
INTRODUCTION |
|---|
|
|
|---|
After endocytosis, many growth factor and hormone receptors are
transported to late endocytic compartments and degraded. This leads to
the down-regulation of receptors, which is important to control their
cell surface expression, and thereby the transduction of signals
delivered in response to growth factors and hormones. This process
requires sorting of receptors in early endocytic compartments and
further transport to late compartments, where they are degraded
(Mukherjee et al., 1997
).
We recently investigated the intracellular fate of a growth factor
receptor, the interleukin 2 receptor (IL2R). The cytokine interleukin 2 (IL2) is produced by activated helper T lymphocytes and acts as a
potent proliferation and differentiation factor on a variety of cells
of the immune system. High-affinity IL2 receptors
(Kd
10-100 pM) are composed of
three distinct components, the
,
, and
chains, that are
associated in a noncovalent manner (Minami et al., 1993
).
Both the
and
chains, but not the
chain, belong to the
cytokine receptor superfamily (Bazan, 1990
). This hematopoietic
cytokine receptor family includes receptors for several cytokines such
as erythropoietin, the granulocyte colony-stimulating factor, the
granulocyte-macrophage colony-stimulating factor, the leukemia
inhibitory factor, growth hormone, prolactin, and ciliary neurotrophic
factor. Many receptor subfamily members share at least one component;
thus, the receptors for IL2, 4, 7, 9, and 15 have a common
chain,
and the receptors for IL2 and IL15 share the
chain (reviewed by
Sugamura et al., 1996
).
One of the early events following IL2 binding to high-affinity
receptors on the cell surface is the efficient internalization of IL2
receptor complexes (Duprez et al., 1988
; Subtil et
al., 1994
). After endocytosis, the three subunits are sorted
differently: the
chain recycles to the plasma membrane, whereas the
and
chains are targeted to late endocytic compartments
(Hémar et al., 1995
).
Little is known about the molecular mechanisms controlling
intracellular sorting of the subunits. We have previously shown that a
motif of 10 amino acids in the cytosolic tail of IL2R
is sufficient
to retarget a normally recycling receptor toward degradation
compartments (Subtil et al., 1997
). Accordingly, deletion of
this signal strongly impaired IL2R
degradation. Further molecular characterization of this motif showed that it was different from the
well-documented tyrosine and di-leucine families of trafficking signals
(Subtil et al., 1998
).
What are the cellular mechanisms responsible for the sorting of the
subunit to late compartments and its final degradation? It is known
that cells degrade proteins generally by two major systems: the
lysosomes and the ubiquitin/proteasome system. Lysosomes are in general
responsible for the degradation of membrane and extracellular proteins
that enter cells by endocytosis. The ubiquitin/proteasome pathway is
involved in the degradation of cytosolic and nuclear proteins
(Weissman, 1997
). Ubiquitin is a 76 amino-acid polypeptide expressed in
all eucaryotic cells and highly conserved from yeast to human.
Classically, it is reported that degradation of proteins by the
proteasome involves two distinct and successive steps (reviewed by
Hershko and Ciechanover, 1998
). First, multiple ubiquitin molecules are
covalently linked to the target protein via a lysine residue, and then
the ubiquitinated protein is degraded by the 26S proteasome. Ubiquitin
molecules are added to target proteins through the sequential action of
three enzymes; ubiquitin is first activated in an ATP-dependent manner
by a specific activating enzyme (E1) and then transferred to an
ubiquitin carrier protein (E2). Next, activated ubiquitin is linked to
a lysine residue of the substrate protein, either directly or in
cooperation with an ubiquitin ligase (E3). In most species, only one E1
enzyme but multiple E2 and E3 enzymes have been described.
Recently, it has been shown that besides its role in cytosolic and
nuclear protein degradation, the ubiquitin-conjugating machinery and
the proteasome may play a role in the sorting of various membrane
anchored-proteins (reviewed by Bonifacino and Weissman, 1998
; Hicke,
1999
; Strous and Govers, 1999
). A clear link between the
ubiquitin/proteasome system and several membrane proteins'
down-regulation has been established. Involvement of ubiquitin/proteasome pathway in the down-regulation of some mammalian cell surface receptors was demonstrated (reviewed by Bonifacino and
Weissman, 1998
; Hicke, 1999
; Strous and Govers, 1999
). Ubiquitination of some of these mammalian plasma membrane proteins might serve as a
signal for their entry into the endocytic pathway. In yeast, mono- or
diubiquitination in this process has been shown to be sufficient for
several membrane proteins (Galan and Haguenauer-Tsapis, 1997
; Terrell
et al., 1998
; Lucero et al., 2000
). In some cases a direct role of the ubiquitin/proteasome system in the intracellular degradation of membrane proteins was suggested (Laing and Beyer, 1995
;
Mori et al., 1995
; Jeffers et al., 1997
; Staub
et al., 1997
).
In the present article, we have investigated the role of ubiquitination
as well as of proteasomes in the down-modulation of IL2R
and of a
chimera carrying its degradation targeting signal.
| |
MATERIALS AND METHODS |
|---|
|
|
|---|
Cells, Monoclonal Antibodies, and Reagents
IARC 301.5 is a subclone from a cell line derived from a human T
lymphoma, which expresses high- and low-affinity IL2 receptors (Duprez
et al., 1985
, 1988
). YT12881, a subclone from the natural killer cell line YT, which expresses the IL2R
and
chains, was
provided by Dr. Kendall Smith (Dartmouth Medical School, NH) (Teshigawara et al., 1987
). IARC301.5, YT, and
erythroleukemia K562 cells were grown in suspension in RPMI 1640. The
Chinese lung cell line ts20 used in this study was kindly provided by Dr. G.J. Strous (Utrecht University, The Netherlands) and is
characterized by an inactive ubiquitin conjugating system at the
nonpermissive temperature of 42°C (Kulka et al., 1988
).
ts20 cells were maintained in culture at 33°C in DMEM. All culture
media were supplemented with 10% decomplemented fetal calf serum and 2 mM L-glutamine. Stably transfected K562 or ts20
cells were grown in the same medium supplemented with 1.5 mg/ml G418
(Geneticin; Life Technologies, Gaithersburg, MD).
Mouse monoclonal antibodies (mAbs) 7G7B6 (IgG2a) and 2A3A1H (IgG1)
directed against the
chain of the IL2 receptor (IL2R
) were
obtained from the American Type Culture Collection (Rockville, MD).
Mouse mAb341 (IgG1) and 561 (IgG2a), directed against the
chain,
were kind gifts from Dr. R. Robb (Dupont Merck Pharmaceutical, Wilmington, DE) (Voss et al., 1993
). The rabbit polyclonal
anti-ubiquitin antiserum was purchased from Sigma (St. Louis, MO), the
mouse monoclonal anti-ubiquitin antibody (IgG1) was from Zymed
Laboratories (San Francisco, CA), and the anti-human
lysosome-associated membrane protein-1 (Lamp-1) H4A3 was from the
Developmental Studies Hybridoma bank (University of Iowa, Iowa City,
IA). Phycoerythrin-conjugated goat F(ab)'2 anti-murine IgG was obtained
from Immunotech (Marseilles, France) and peroxidase-conjugated (sheep)
anti-mouse immunoglobulins from Amersham Pharmacia Biotech (Uppsala,
Sweden). Fluorescein-labeled anti-mouse IgG1 and Texas Red-labeled
anti-mouse IgG2a were from Southern Biotechnology (Birmingham, AL.).
Human transferrin was labeled with Cy5 dye (Amersham Pharmacia
Biotech), by using the CyDye Fluorolink reactive dye kit according to
the manufacturer's instructions. Enhanced chemiluminescence and
enhanced chemifluorescence-Western Blotting detection reagents
were from Amersham Pharmacia Biotech.
Chloroquine, leupeptin, and N-acetyl-L-L-leucyl-norleucinal (ALLN) were purchased from Sigma, MG132 from Calbiochem (La Jolla, CA), and lactacystin from Alexis (COGER, France). Lactacystin and ALLN were dissolved in ethanol and dimethyl sulfoxide, respectively. Throughout the experiments, control cells were preincubated with the same solvent concentration in the culture medium at a final concentration not exceeding 0.5%.
Plasmids
The cDNA coding for the IL2R
chain was isolated from plasmid
pdKCR
, kindly provided by Dr. T. Kono (Osaka University, Osaka, Japan) and subcloned in NT vector, a gift from Dr. C. Bonnerot (Institut Curie, Paris, France) as previously described (Subtil et al., 1997
). The
Y
18-27 chimera was
generated by polymerase chain reaction (PCR). Briefly, the transferrin
receptor YTRF internalization signal and the
chain sorting signal
were inserted in the cytosolic part of the IL2R
chain, slightly
modified by the introduction of a cloning cassette (Subtil et
al., 1997
). The primary sequence of the cytosolic part of the
Y
18-27 chimera is
TWQRRQRKSEPLSYTRFQASSPDPSKFFSQL. Mutations of the two lysine residues
at position 8 and 26 in the cytosolic portion of the chimera,
introducing, respectively, a glutamic acid and an alanine at these
positions, were also performed by PCR. The resulting mutated chimera
Y
18-27 (K8E/K26A)
will be referred to as
Lys.
Cell Transfection
To generate stably transfected K562 or ts20 cells, 7 × 106 cells were washed once in DMEM, 4.5 g/l
glucose, and resuspended in 800 µl of the same medium, with 20 µg
of the plasmid of interest. Electroporation was performed using the
Easyject electroporator (Eurogentec, Seraing, Belgium) with a single
pulse, 240 V, 1500 µF. Selection with 1.5 mg/ml G418 was initiated
2 d after transfection, and the cells were cloned in 96-well
dishes. G418-resistant clones were assayed for expression by flow
cytometry by using anti-
(2A3A1H) or anti-
(341) antibodies. The
expression levels of recombinant proteins in all clones tested were the
same as or less than their normal level in activated lymphocytes.
Internalization Assays
Internalization of 2A3A1H or 341 antibodies directed,
respectively, against the chimeras and the
chain were quantitated by flow cytometry as previously described (Subtil et al.,
1998
). Briefly, cells were incubated at 4°C for 60 min with 2A3A1H or 341 antibody (1/2000 ascites fluid). The cells were washed in chilled
phosphate-buffered saline (PBS) at 4°C, and then they were incubated
at 37°C for the indicated times to allow internalization, rapidly
cooled to 4°C, and washed twice in cold PBS, 2% fetal calf serum.
The cells were then incubated at 4°C for 1 h with phycoerythrin-conjugated goat F(ab)'2 anti-murine IgG and washed once
at 4°C. Expression of receptors remaining at the cell surface was
assayed using a FACScan flowcytometer (Becton Dickinson, San Jose, CA).
Internalization was monitored by the decrease in mean fluorescence as a
function of time at 37°C. For the mutant ts20 cells, after 1-h
preincubation at 30°C or at 42°C, the internalization assays were
performed at the same temperatures. The background fluorescence
intensity, determined with cells incubated only with the secondary
antibody, was <10% and was substracted.
Cell Surface Half-Life Measurements
To measure the half-life on the cell surface of IL2R
or of
the chimeras, cells were incubated with 50 µM cycloheximide (Sigma) to prevent the synthesis of new receptors. After different times of
incubation at 37°C in culture medium with cycloheximide, the cells
were cooled to 4°C and cell surface expression of the remaining receptors was assayed by flow cytometry as described (Hémar and Dautry-Varsat, 1990
). Time zero on the graph corresponds to a 30-min
incubation in the presence of cycloheximide, a time length necessary
for the newly synthesized IL2 receptor to reach the cell surface
(Duprez and Dautry-Varsat, 1986
). For the ts20 cell line, cells were
preincubated 1 h at 30°C or at 42°C, and half-life measurement
performed at these same temperatures. All experiments were done at
least four times. The means ± SE are shown.
Immunofluorescence and Confocal Microscopy
K562 cells transfected with
Y
18-27 or with the
Lys mutant were collected and incubated for 4 h at 37°C with
or without various reagents, and then cycloheximide was added in the
presence of Cy5-conjugated human transferrin for the last 30 min. The
cells were washed twice in cold PBS and fixed in 3.7% paraformaldehyde and 0.03 M sucrose as previously described. Cells were then incubated with anti-
(7G7B6) and anti-Lamp-1 (H4A3) mAb diluted in the permeabilizing buffer. After two washes in permeabilizing buffer, the
cells were further incubated for 1 h in the permeabilizing buffer
containing labeled secondary antibodies. After washes and sample
mounting in 100 mg/ml Mowiol (Calbiochem), 100 mg/ml
1.4-diazalbicyclo(2.2.2)octane (Sigma), 25% glycerol (vol/vol), 100 mM
Tris-HCl, pH 8.5, the cells were examined under a confocal microscope
(LSM 510; Zeiss, Jena, Germany). Fluorescein, Texas-Red and Cy5
dyes were excited by laser light at 488, 543, or 633 nm, respectively.
To avoid bleed-through effect in multiple staining experiments, each
dye was scanned independently using the multitracking function of the
LSM 510 unit. Images were merged and colocalization evaluated by the
LSM 510 software. Quantification of colocalization is expressed as the
percentage of green pixels corresponding to the
Y
18-27 or the
lys signal, which also contain the staining corresponding to the
transferrin receptor or Lamp-1 signal relative to the total number of
green pixels.
Immunoprecipitation and Western Blotting
IARC 301.5 cells or YT cells (2.5 × 107 cells/immunoprecipitate) were incubated with
12.5 µM ALLN or 10 µM MG132 or 200 µM chloroquine for 3 h.
After two washes in cold PBS, the cells were lysed in 0.5% NP-40
(Sigma) complemented with 1% protease inhibitor cocktail (Sigma), 2 mM
phenylmethylsulfonyl fluoride, and 5 µM ALLN for 10 min at 4°C.
After a further 30-min incubation at 37°C in the presence of 1%
Triton X-100 and 10 passages through a syringe needle, a postnuclear
supernatant was collected by centrifugation (800 × g,
4°C). Lysate supernatants were immunoprecipitated with mAb 561 (anti-IL2R
), or with a rabbit anti-ubiquitin antiserum, or with a
mouse monoclonal anti-ubiquitin antibody or with an irrelevant
antibody. The immune complexes were recovered by the addition of
protein A-Sepharose CL-4B (Amersham Pharmacia Biotech) and after five
washes in lysis buffer, bound proteins eluted into electrophoresis
sample buffer were resolved by SDS-PAGE and transferred to
polyvinylidene difluoride membranes (Amersham Pharmacia Biotech). Membranes were probed with an anti-IL2R
mAb (341) and an alkaline phosphatase-conjugated or peroxidase-conjugated secondary antibody was
used for immunodetection. After washing, the membranes were incubated
with enhanced chemiluminescence or Vistra (enhanced chemifluorescence)
reagent for 5-20 min. A quantitative analysis of Western blots was
conducted for some experiments by scanning on a Storm
Phosphorimager/Fluorimager (Molecular Dynamics, Sunnyvale, CA). Bands
were quantitated and density values were in the linear range of the
detection method.
| |
RESULTS |
|---|
|
|
|---|
An Active Ubiquitination System Is Required for Efficient
Down-Regulation of IL2R
Chain
After internalization, the IL2R
chain is sorted to late
endosomes (Hémar et al., 1995
). To determine whether
ubiquitination was involved in this process, we made use of the ts20
cell line carrying a temperature-sensitive ubiquitin-activating enzyme
E1. This enzyme is fully functional when cells are incubated at 30°C, but becomes inactivated when cells are incubated at the nonpermissive temperature of 42°C, thereby impairing ubiquitination of proteins (Kulka et al., 1988
). Stably transfected ts20 cells
expressing IL2R
chain were thus preincubated at permissive or
nonpermissive temperature before and during the assays. We have
previously demonstrated that the follow up, by flow cytometry analysis,
of the disappearance of receptors from the surface of cells incubated
with cycloheximide accounts for the analysis of their intracellular
degradation (Subtil et al., 1997
). Results (Figure
1A) show that the half-life of IL2R
was significantly increased when the cells were incubated at 42°C in
comparison to those incubated at 30°C. This difference was not due to
a decrease in internalization rate, because IL2R
was internalized
more rapidly at nonpermissive temperature (Figure 1B). It was checked
that in the parental cell line E36, the IL2R
half-life was not
significantly increased at nonpermissive temperature compared with
permissive temperature (our unpublished results). These data strongly
suggest that an active ubiquitination machinery is required for the
efficient degradation of the
chain of the IL2R, but not for its
internalization.
|
Biochemical Study of IL2R
Chain Ubiquitination
It was previously reported that, after internalization, the
IL2R
chain is sorted to late endosomes/lysosomes and that its degradation is inhibited in the presence of weak bases (Weissman et al., 1986
; Hémar et al., 1995
). We
therefore treated lymphocytic cells with chloroquine, a weak base that
inhibits lysosomal function by increasing the pH of acidic
intracellular compartments, and immunoprecipitated cell lysates with an
anti-IL2R
. After electrophoresis, the presence of IL2R
chain was
revealed and quantitated by immunoblotting with an
anti-IL2R
antibody and fluorimager analysis. The intensity of the
band corresponding to IL2R
(70 kDa) increased fourfold following
chloroquine treatment, compared with control cells (Figure 2, lanes a and b), confirming the
involvement of the acidic compartments in the degradation of this
receptor. The presence of a band of higher molecular weight (78 kDa)
was also observed and this upper band was also more intense when
chloroquine was used (lane b). Because ubiquitin is a small protein of
~7.5 kDa, the 78-kDa form of the
chain could be attributed to a
ubiquitin moiety appended to the IL2R
chain. To test this
hypothesis, the lysates of cells incubated with or without chloroquine
were immunoprecipitated with a rabbit polyclonal anti-ubiquitin
antibody and immunoblotting was performed with an
IL2R
-specific antibody. The anti-ubiquitin antibody was able to
precipitate the 78-kDa form of the
chain that accumulates when
cells are incubated with chloroquine. It indicates that this band
corresponds to the ubiquitinated
chain (Figure 2, lanes c and d).
No higher molecular weight bands were detectable, suggesting that
IL2R
is only monoubiquitinated.
|
Effect of Mutating Lysine Residues
It is well established that ubiquitin is coupled to proteins on
their lysine residues (Hershko and Ciechanover, 1998
). To assess the
role of the presence of potential ubiquitination sites in the function
of the IL2R
chain degradation signal, we made use of a chimeric
receptor,
Y
18-27,
carrying this sorting signal and containing only two cytosolic lysine
residues. We had previously shown that a 10 amino-acid motif in this
chain, including residues 18 to 27 (
18-27 sequence), was sufficient
to mediate the efficient sorting of a recycling receptor,
Y, toward degradation. The
Y chimera was constructed by inserting the
strong tyrosine-based internalization signal of the transferrin
receptor YTRF at the carboxyl end of the IL2R
chain cytosolic
domain. This chimera is efficiently internalized and recycled back to
the cell surface. In contrast, when the degradation motif
18-27 was added to the cytosolic domain of the
Y chimera, the resulting receptor,
Y
18-27, was rapidly
degraded after endocytosis (Subtil et al., 1997
). We mutated
the two lysine residues contained in the cytosolic part of the
Y
18-27 chimera, which
are potential ubiquitination sites. The sorting of this lysine-mutated
receptor was analyzed by measuring its internalization rate and its
half-life at the cell surface. As shown in Figure
3, the mutated chimeric receptor was
internalized with the same kinetics as
Y
18-27, but was less efficiently degraded because its half-life was doubled. The chimera carrying only one of the two mutations had the same degradation rate as
the nonmutated
Y
18-27
chimera (our unpublished results), showing that the absence of both
lysine residues was necessary to increase the half-life. These results
imply that the sorting signal of the IL2R
chain toward degradation
needs the presence of lysine residues to function.
|
Effect of Proteasome Inhibitors on IL2R
Chain Down-Modulation
We then wanted to evaluate the contribution of proteasomes. To
this end, we performed immunoblot experiments on
lymphocytic cell lysates incubated with or without MG132, a strong
inhibitor of proteasome (Lee and Goldberg, 1998
). Lysates were
immunoprecipitated with mouse monoclonal anti-IL2R
or anti-ubiquitin
antibodies and immunoblotting was performed with an
IL2R
-specific antibody. Treatment with MG132 increased the total
amount of IL2R
in the cell lysate, but more particularly the upper
band (Figure 4, lanes a and b). This
upper band is the ubiquitinated form of the receptor as shown by
immunoprecipitation with an anti-ubiquitin mAb (Figure 4, lane c). The
same results were obtained when another proteasome inhibitor, ALLN (Lee
and Goldberg, 1998
), was used (our unpublished results). These results
show that proteasome inhibitors lead to the accumulation of the
monoubiquitinated form of the
chain.
|
Effect of Lysosome or Proteasome Inhibitors on Down-Regulation of
IL2R
or of a Chimera Carrying Its Degradation Sorting Signal
We next measured the effect of proteasome inhibitor on IL2R
chain half-life and endocytosis. We observed that treating human T
cells with the specific proteasome inhibitor lactacystin (Lee and
Goldberg, 1998
) led to a significant decrease in the degradation rate
of the IL2R
chain, as shown by the increase of its half-life (300 min instead of 90 min) (Figure 5A). This
confirms the observation that the use of proteasome inhibitors leads to
an accumulation of IL2R
. In contrast, the internalization rate
(Figure 5B) was only slightly affected. Therefore, proteasome
inhibitors affect the intracellular routing of IL2R
toward
degradation without significantly altering its internalization.
|
The effects of lactacystin on the degradation and internalization rates
of the
Y
18-27 chimera
were also assayed. The degradation rate of the chimera was reduced in
the presence of lactacystin but not its uptake (Figure
6). We also studied the effect of the lysosomal protease inhibitor leupeptin and of chloroquine. These compounds strongly impaired the degradation of
Y
18-27 (Figure 6A)
without significantly affecting the internalization rate of the chimera
(Figure 6B). These results show that the two different intracellular
proteolytic systems, lysosomes and proteasomes, are involved in the
turnover of IL2R
chain or of the chimeric receptor containing its
degradation signal.
|
Analysis of Intracellular Localization of Receptors by Confocal Microscopy
The intracellular localization of the chimeric
Y
18-27 receptor in
cells treated with lactacystin and of the
lys mutant was analyzed by
confocal microscopy. After treatment with lactacystin when indicated,
the cells were fixed and permeabilized and the chimeric receptor or
lys mutant was stained. In parallel, the transferrin receptor (TfR),
a marker of early and recycling endosomes or the late endosome/lysosome
marker Lamp-1 were labeled. The cells were observed by confocal
microscopy (Figure 7, A-C) and the
extent of colocalization of the chimeric
Y
18-27 or
lys mutant receptor with the TfR or Lamp-1 was measured as described in
MATERIALS AND METHODS (Figure 7D). In control cells expressing
Y
18-27, the extent of
colocalization with the Tf receptor was low, ~20%, whereas with
Lamp-1, it was higher, ~60% (Figure 7, A and D). This result was
expected because this chimera is first internalized in early endosomes
and then sorted to late endosomes/lysosomes (Subtil et al.,
1997
). In contrast, the
lys mutant chimera displayed a different
pattern: the mutated chains accumulated in a compartment strongly
stained with the transferrin receptor, but poorly with the lysosomal
marker (Figure 7, B and D), suggesting some retention in the
early/recycling compartment and/or less efficient sorting to late
endosomes.
|
In cells incubated with lactacystin (Figure 7, C and D), the chimera appeared to be colocalized equally with Lamp-1 and the transferrin receptor, ~50% suggesting that in the presence of lactacystin it is less efficiently targeted to late endosomes/lysosomes.
In the course of this study, we noticed that in cells treated with
lactacystin
Y
18-27
receptors, in some areas, colocalized with both Lamp-1 and TfR. This
can be due to the fact that the proteasome inhibitor might also alter
trafficking of Lamp-1. The extent of colocalization between Lamp-1 and
TfR was quantified and we found that only 7% of Lamp-1 colocalized
with TfR in control cells versus 28% in cells treated with lactacystin
(Figure 7E). The increase in the colocalization of these intracellular
markers suggests that proteasome inhibitors might cause a global
disturbance of protein trafficking in endocytic pathway.
| |
DISCUSSION |
|---|
|
|
|---|
Various growth factor receptors are found to be ubiquitinated at
the plasma membrane and a direct involvement of the
ubiquitin/proteasome system in the down-regulation of some of them has
been demonstrated (Bonifacino and Weissman, 1998
; Hicke, 1999
; Strous
and Govers, 1999
). In this article, we have investigated its role in
the down-modulation of the IL2R
. We have shown that a fraction of
IL2R
can be monoubiquitinated and that indeed, ubiquitination of
IL2R
or of the chimera containing its degradation signal,
Y
18-27, is required
for the sorting toward late degradative compartments. Our results also
indicate that impairment of proteasome function, by the use of
inhibitors, affects the IL2R
degradation. Thus, the IL2R
chain
joins the increasing number of membrane receptors shown to be
down-regulated, at least in part, by their ubiquination and/or by
proteasomes. However, the mechanism by which the ubiquitin/proteasome
machinery acts on the intracellular fate of receptors is still unclear. From our current knowledge of how degradation of cell surface receptors
occurs, there are three steps at which ubiquitin/proteasome system can
be involved: internalization, intracellular routing, and processing of
the receptor by itself.
Ubiquitination-dependent endocytosis has been reported for several
yeast membrane proteins: the ABC peptide transporter, the
-factor
receptor, the a-factor receptor, uracyl permease Fur4p, and the maltose
permease transporter (reviewed by Bonifacino and Weissman, 1998
; Hicke,
1999
; Strous and Govers, 1999
). A role for mono- or diubiquitination of
some of these receptors at the internalization step of endocytosis has
been shown (Galan and Haguenauer-Tsapis, 1997
; Terrell et
al., 1998
; Lucero et al., 2000
). Recently, it has been
demonstrated that the monoubiquitin chain appended to the
-factor
receptor (Shih et al., 2000
) or to a-factor receptor (Roth
and Davis, 2000
) itself carries the information sufficient for
internalization. Similarly, in mammalian cells, a recent report showed
that a signal within a single ubiquitin moiety appended to a chimeric
receptor is involved in its internalization (Nakatsu et al.,
2000
). For two other mammalian membrane proteins, ubiquitination was
clearly involved in their internalization; the epithelial sodium
channel (Staub et al., 1997
) and the growth hormone receptor
(GHR) (Strous et al., 1996
). However, the mechanism by which
ubiquitination initiates their uptake is still obscure. The interaction
between the ubiquitin/proteasome system and cell surface receptors was
further analyzed for the GHR, which belongs to the same cytokine
receptor family as the IL2R
chain. For GHR, ubiquitination of the
receptor itself does not appear to be necessary (Govers et
al., 1999
). One possibility is that the GHR needs to bind to a
factor, regulated by the ubiquitin/proteasome pathway, before
endocytosis can occur (van Kerkhof et al., 2000
). From the
experiments reported here, different conclusions can be drawn for the
IL2R
chain. Impairment of ubiquitination machinery in ts20 cells
shows that ubiquination of receptors is not required for their cellular
uptake. Use of proteasome inhibitors also revealed that the proteasomes
are not involved in the internalization step of IL2R
or of the
chimera
Y
18-27,
carrying its sorting signal. Similarly, the overall turnover, but not
the internalization, of the PDGF receptor was shown to be
ubiquitin/proteasome-dependent (Mori et al., 1995
).
The second step at which ubiquitination or proteasome action may be
implicated is after internalization, in routing of the receptor from
early endocytic to late degradation compartments. Our studies on the
chimera
Y
18-27, which
is degraded after endocytosis, as is the IL2R
receptor, show that
mutation of the lysine residues (
lys) impairs receptor degradation
and causes its accumulation in early/recycling endosomes. This is a
strong argument in favor of a direct role of receptor ubiquitination as
a signal in sorting from early/recycling to late endocytic
compartments. Interestingly, ubiquitination of proteins can be
regulated by specific ubiquitin proteases (Wilkinson, 1997
). In this
respect, it is worth noting that one of these deubiquitinating enzymes
(named DUB-2) is induced by IL2 and down-regulated after the
initiation of T-cell activation (Zhu et al., 1997
).
The role of ubiquitination in IL2R
sorting could be independent of
proteasome function. In fact, in agreement with this we detected only a
monoubiquitinated form of IL2R
, whereas at least four residues of
ubiquitin appear to be required for recognition by the proteasome
(Deveraux et al., 1994
; Thrower et al., 2000
). However, treatment of cells with proteasome inhibitors also affected IL2R
and
Y
18-27
degradation. Moreover, we showed that the sorting of this receptor
seemed to be altered because, in the presence of lactacystin, the
Y
18-27, which is
normally directed toward degradation (Subtil et al., 1997
),
colocalizes equally with TfR and the lysosomal marker Lamp-1. These
data suggest that the proteasome function is necessary for a proper
sorting of receptors carrying IL2R
signal. However, we observed
that, in the presence of the proteasome inhibitor, the extent of
colocalization of two markers of normally distinct compartments, TfR
and Lamp-1, was increased. This indicates that the proteasome inhibitor
might have a general effect on intracellular trafficking, compromising
several cellular compartments, which may explain the effect on the
degradation of IL2R
. Effect of proteasome malfunction in the overall
defect of vacuolar integrity was also one of the models proposed for the proteasome-dependent degradation of the a-factor transporter in
yeast (Loayza and Michaelis, 1998
). Interestingly, a link between ubiquitin system and maintenance of intracellular integrity has also
previously been described (Lenk et al., 1992
). In this
report, it was shown, using ts20 mutant cell line, that a functional
ubiquitination machinery is necessary for the maturation of autophagic
vacuoles. The role of proteasome in the routing of membrane proteins
from the endocytic to degradation compartments is unclear. One possible mechanism is that proteasome function might be involved in the regulation of a protein playing a crucial role in trafficking through
the endocytic pathway. One potential candidate might be the recently
described sorting nexin SNX15 (Barr et al., 2000
).
The third possible action of ubiquitin/proteasome system is on the
degradation of the receptor itself. Proteasomal degradation of some
mammalian receptors has previously been described. For the
platelet-derived growth factor (Mori et al., 1995
), the Met Tyrosine kinase receptor (Jeffers et al., 1997
), and the GHR
(van Kerkhof et al., 2000
), it has been proposed that both
proteasomes and lysosomes might function to degrade different parts of
given receptors. Herein, we have confirmed that lysosomes were involved in IL2R
degradation because degradation was inhibited by chloroquine or leupeptin. Because, as discussed above, proteasome inhibitors affected the trafficking of intracellular markers, we could not question whether proteasomes were also directly involved in the degradation of IL2R
. Again, the fact that only monoubiquitinated form of the
chain was detected argues against this possibility (Deveraux et al., 1994
; Thrower et al., 2000
).
In conclusion, our data, together with other recent reports, indicate
that the ubiquitin/proteasome system, in addition to its involvement in
cell cycle and signal transduction, in the elimination of endoplasmic
reticulum-retained proteins, is also a key player in the modulation of
the expression of cell surface growth factor receptors. Its role in
many aspects of cell life (Bonifacino and Weissman, 1998
; Ciechanover,
1998
; Hershko and Ciechanover, 1998
) supports the emerging idea that
the proteasome/ubiquitin system might play an essential role in general
intracellular protein routing and turnover.
| |
ACKNOWLEDGMENTS |
|---|
We are grateful to Raymond Hellio and Pascal Roux for help with confocal microscopy, Annick Dujeancourt for skillfull technical assistance. The confocal microscope was purchased with a donation from Marcel and Liliane Pollack. This work was supported by the Association pour la Recherche sur le Cancer (no. 5260)
| |
FOOTNOTES |
|---|
* These authors contributed equally to this work.
Corresponding author. E-mail address:
adautry{at}pasteur.fr.
| |
ABBREVIATIONS |
|---|
Abbreviations used:
ALLN, N-acetyl-L-L-leucyl-norleucinal;
GHR, growth hormone receptor;
IL2, interleukin 2;
IL2R
, interleukin
2 receptor
chain;
IL2R
, interleukin 2 receptor
chain;
Lamp-1, lysosome-associated membrane protein-1;
mAb, monoclonal
antibody;
PBS, phosphate-buffered saline;
PCR, polymerase chain
reaction;
TfR, transferrin receptor.
| |
REFERENCES |
|---|
|
|
|---|
chain gene transcription but not its cell surface expression: the
chain stability can explain this discrepancy.
Eur. J. Immunol.
20, 2629-2635[Medline].
,
and
chains.
J. Cell Biol.
129, 55-64
-receptor involves ubiquitin-proteasome proteolytic pathway.
J. Biol. Chem.
270, 29447-29452
-helical signal in the cytosolic domain of the interleukin 2 receptor
chain mediates sorting towards degradation after endocytosis.
J. Cell Biol.
136, 583-595
chain toward intracellular degradation.
J. Biol. Chem.
273, 29424-29429
chain: its role in the multiple cytokine receptor complexes and T cell development in XSCID.
Annu. Rev. Immunol.
14, 179-205[Medline].
chain.
Proc. Natl. Acad. Sci. USA
90, 2428-2432This article has been cited by other articles:
![]() |
S. Nam, K. Min, H. Hwang, H.-o. Lee, J. H. Lee, J. Yoon, H. Lee, S. Park, and J. Lee Control of Rapsyn Stability by the CUL-3-containing E3 Ligase Complex J. Biol. Chem., March 20, 2009; 284(12): 8195 - 8206. [Abstract] [Full Text] [PDF] |
||||
![]() |
Y. Yamashita, K. Kojima, T. Tsukahara, H. Agawa, K. Yamada, Y. Amano, N. Kurotori, N. Tanaka, K. Sugamura, and T. Takeshita Ubiquitin-independent binding of Hrs mediates endosomal sorting of the interleukin-2 receptor {beta}-chain J. Cell Sci., May 15, 2008; 121(10): 1727 - 1738. [Abstract] [Full Text] [PDF] |
||||
![]() |
Z. Lu, H.-S. Je, P. Young, J. Gross, B. Lu, and G. Feng Regulation of synaptic growth and maturation by a synapse-associated E3 ubiquitin ligase at the neuromuscular junction J. Cell Biol., July 30, 2007; 177(6): 1077 - 1089. [Abstract] [Full Text] [PDF] |
||||
![]() |
Y. Pak, W. K. Glowacka, M. C. Bruce, N. Pham, and D. Rotin Transport of LAPTM5 to lysosomes requires association with the ubiquitin ligase Nedd4, but not LAPTM5 ubiquitination J. Cell Biol., November 20, 2006; 175(4): 631 - 645. [Abstract] [Full Text] [PDF] |
||||
![]() |
J.-C. Lu, T. M. Piazza, and L. A. Schuler Proteasomes Mediate Prolactin-induced Receptor Down-regulation and Fragment Generation in Breast Cancer Cells J. Biol. Chem., October 7, 2005; 280(40): 33909 - 33916. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. Walrafen, F. Verdier, Z. Kadri, S. Chretien, C. Lacombe, and P. Mayeux Both proteasomes and lysosomes degrade the activated erythropoietin receptor Blood, January 15, 2005; 105(2): 600 - 608. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. H. Hryciw, J. Ekberg, A. Lee, I. L. Lensink, S. Kumar, W. B. Guggino, D. I. Cook, C. A. Pollock, and P. Poronnik Nedd4-2 Functionally Interacts with ClC-5: INVOLVEMENT IN CONSTITUTIVE ALBUMIN ENDOCYTOSIS IN PROXIMAL TUBULE CELLS J. Biol. Chem., December 31, 2004; 279(53): 54996 - 55007. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Carter, S. Urbe, and M. J. Clague The Met Receptor Degradation Pathway: REQUIREMENT FOR LYS48-LINKED POLYUBIQUITIN INDEPENDENT OF PROTEASOME ACTIVITY J. Biol. Chem., December 17, 2004; 279(51): 52835 - 52839. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. Degnin, F. Jean, G. Thomas, and J. L. Christian Cleavages within the Prodomain Direct Intracellular Trafficking and Degradation of Mature Bone Morphogenetic Protein-4 Mol. Biol. Cell, November 1, 2004; 15(11): 5012 - 5020. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Gentzsch, X.-B. Chang, L. Cui, Y. Wu, V. V. Ozols, A. Choudhury, R. E. Pagano, and J. R. Riordan Endocytic Trafficking Routes of Wild Type and {Delta}F508 Cystic Fibrosis Transmembrane Conductance Regulator Mol. Biol. Cell, June 1, 2004; 15(6): 2684 - 2696. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. Dong, W. Chen, A. Welford, and A. Wandinger-Ness The Proteasome {alpha}-Subunit XAPC7 Interacts Specifically with Rab7 and Late Endosomes J. Biol. Chem., May 14, 2004; 279(20): 21334 - 21342. [Abstract] [Full Text] [PDF] |
||||
![]() |
N. Suzuki, Y. Shibata, T. Urano, T. Murohara, T. Muramatsu, and K. Kadomatsu Proteasomal Degradation of the Nuclear Targeting Growth Factor Midkine J. Biol. Chem., April 23, 2004; 279(17): 17785 - 17791. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Polo, S. Confalonieri, A. E. Salcini, and P. P. Di Fiore EH and UIM: Endocytosis and More Sci. Signal., December 16, 2003; 2003(213): re17 - re17. [Abstract] [Full Text] [PDF] |
||||
![]() |
W. J. Netzer, F. Dou, D. Cai, D. Veach, S. Jean, Y. Li, W. G. Bornmann, B. Clarkson, H. Xu, and P. Greengard Gleevec inhibits {beta}-amyloid production but not Notch cleavage PNAS, October 14, 2003; 100(21): 12444 - 12449. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. E. Hammond, S. Carter, J. McCullough, S. Urbe, G. Vande Woude, and M. J. Clague Endosomal Dynamics of Met Determine Signaling Output Mol. Biol. Cell, April 1, 2003; 14(4): 1346 - 1354. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Panigada, S. Porcellini, E. Barbier, S. Hoeflinger, P.-A. Cazenave, H. Gu, H. Band, H. von Boehmer, and F. Grassi Constitutive Endocytosis and Degradation of the Pre-T Cell Receptor J. Exp. Med., June 17, 2002; 195(12): 1585 - 1597. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. E. Lorenzo, J. U. Jung, and H. L. Ploegh Kaposi's Sarcoma-Associated Herpesvirus K3 Utilizes the Ubiquitin-Proteasome System in Routing Class I Major Histocompatibility Complexes to Late Endocytic Compartments J. Virol., May 3, 2002; 76(11): 5522 - 5531. [Abstract] [Full Text] [PDF] |
||||
![]() |
N. Bishop, A. Horman, and P. Woodman Mammalian class E vps proteins recognize ubiquitin and act in the removal of endosomal protein-ubiquitin conjugates J. Cell Biol., April 1, 2002; 157(1): 91 - 102. [Abstract] [Full Text] [PDF] |
||||
![]() |
Z. Peng, E. Grimberg, and R. Sagi-Eisenberg Suppression of Synaptotagmin II restrains phorbolester-induced downregulation of protein kinase C{alpha} by diverting the kinase from a degradative pathway to the recycling endocytic compartment J. Cell Sci., January 8, 2002; 115(15): 3083 - 3092. [Abstract] [Full Text] [PDF] |
||||
![]() |
N. Bishop, A. Horman, and P. Woodman Mammalian class E vps proteins recognize ubiquitin and act in the removal of endosomal protein-ubiquitin conjugates J. Cell Biol., April 1, 2002; 157(1): 91 - 102. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||