Molecular Biology of the Cell click for CBE Life Science Education Page

Home Help [Feedback] [For Subscribers] [Archive] [Search] [Contents]
 QUICK SEARCH:   [advanced]


     


Originally published as MBC in Press, 10.1091/mbc.01-10-0481 on January 9, 2002
This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow A correction has been published
Right arrow All Versions of this Article:
01-10-0481v1
13/1/1    most recent
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Zhang, X. A.
Right arrow Articles by Hemler, M. E.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Zhang, X. A.
Right arrow Articles by Hemler, M. E.

Vol. 13, Issue 1, 1-11, January 2002

Function of the Tetraspanin CD151-alpha 6beta 1 Integrin Complex during Cellular Morphogenesis

Xin A. Zhang,*dagger Alexander R. Kazarov,dagger Xiuwei Yang, Alexa L. Bontrager, Christopher S. Stipp, and Martin E. HemlerDagger

Dana-Farber Cancer Institute and Department of Pathology, Harvard Medical School, Boston, Massachusetts 02115

Submitted July 17, 2001; Revised October 2, 2001; Accepted October 5, 2001
Monitoring Editor: Martin Schwartz

    ABSTRACT
TOP
ABSTRACT
INTRODUCTION
MATERIALS AND METHODS
RESULTS
DISCUSSION
REFERENCES

Upon plating on basement membrane Matrigel, NIH3T3 cells formed an anastomosing network of cord-like structures, inhibitable by anti-alpha 6beta 1 integrin antibodies. For NIH3T3 cells transfected with human CD151 protein, the formation of a cord-like network was also inhibitable by anti-CD151 antibodies. Furthermore, CD151 and alpha 6beta 1 were physically associated within NIH3T3 cells. On removal of the short 8-amino acid C-terminal CD151 tail (by deletion or exchange), exogenous CD151 exerted a dominant negative effect, as it almost completely suppressed alpha 6beta 1-dependent cell network formation and NIH3T3 cell spreading on laminin-1 (an alpha 6beta 1 ligand). Importantly, mutant CD151 retained alpha 6beta 1 association and did not alter alpha 6beta 1-mediated cell adhesion to Matrigel. In conclusion, the CD151-alpha 6beta 1 integrin complex acts as a functional unit that markedly influences cellular morphogenesis, with the CD151 tail being of particular importance in determining the "outside-in" functions of alpha 6beta 1-integrin that follow ligand engagement. Also, antibodies to alpha 6beta 1 and CD151 inhibited formation of endothelial cell cord-like networks, thus pointing to possible relevance of CD151-alpha 6beta 1 complexes during angiogenesis.

    INTRODUCTION
TOP
ABSTRACT
INTRODUCTION
MATERIALS AND METHODS
RESULTS
DISCUSSION
REFERENCES

Studies of integrin-dependent adhesion, migration, and signaling have focused largely on integrin ligand binding sites (Plow et al., 2000) and on cytoplasmic domains (Liu et al., 2000). Cytoplasmic domain perturbations alter ligand binding ("inside-out" signaling) and ligand binding triggers long-range alterations in cytoplasmic domain interactions ("outside-in" signaling). Integrin functions are modulated also by lateral associations with other transmembrane proteins (Hemler, 1998; Woods and Couchman, 2000). As shown here, outside-in signaling through alpha 6beta 1 integrin is markedly influenced by its lateral association with CD151, a transmembrane-4 superfamily (TM4SF, tetraspanin) protein.

Tetraspanin proteins contain two extracellular loops, four hydrophobic transmembrane domains, and two short cytoplasmic tails. Tetraspanins regulate membrane fusion, trafficking, cell motility, and tumor metastasis (Wright and Tomlinson, 1994; Maecker et al., 1997). Tetraspanins form multimolecular complexes with many other transmembrane proteins, including integrins (Hemler et al., 1996; Hemler, 1998). Despite several reports of tetraspanin-protein complexes, only a few have documented functional relevance. For example, results from CD81-null mice support the relevance of CD81-CD19 association (Maecker and Levy, 1997; Miyazaki et al., 1997; Tsitsikov et al., 1997), CD9 influences the activity of associated HB-EGF (Iwamoto et al., 1994), and antibodies to CD81 and CD151 inhibit the functions of associated integrins (Domanico et al., 1997; Yánez-Mó et al., 1998; Yauch et al., 1998; Stipp and Hemler, 2000). Notably, anti-CD81 and anti-CD151 antibodies inhibited neurite outgrowth only when associated alpha 3beta 1 integrin was engaged with ligand (Stipp and Hemler, 2000).

Among tetraspanin complexes, the CD151-alpha 3beta 1 integrin complex has unusually high stoichiometry, proximity, and stability. A specific site in CD151's large extracellular loop is required for alpha 3beta 1 integrin interaction (Yauch et al., 2000). CD151 also may use the same site to form complexes with alpha 6beta 1, alpha 6beta 4, and other integrins, while influencing cell motility, hemidesmosome formation, and other functions (Yánez-Mó et al., 1998; Fitter et al., 1999; Sincock et al., 1999; Sterk et al., 2000). However, the functional roles of CD151-alpha 6 integrin complexes have not been specifically demonstrated.

We have proposed a "transmembrane linker" model for tetraspanins (Hemler, 1998). In this model, tetraspanin extracellular domains link to integrins, whereas cytoplasmic domains link to intracellular signaling enzymes such as phosphatidylinositol 4-kinase and PKC (Hemler, 1998; Yauch and Hemler, 2000; Zhang et al., 2001a, 2001b). However, the functional relevance of specific tetraspanin cytoplasmic domains has not been shown. Here we demonstrate that the CD151-alpha 6beta 1 integrin complex acts as a functional unit supporting organization of NIH3T3 cells into a network of cord-like structures when cultured on Matrigel. Although the extracellular (and/or transmembrane) region of CD151 mediates alpha 6beta 1 integrin association, the CD151 C terminus is of particular importance for modulating alpha 6 integrin-dependent functions. These results provide perhaps the clearest support to date for a tetraspanin transmembrane linker model in which CD151 links to an integrin (alpha 6beta 1), while using its C-terminal tail to link with intracellular pathways involved in Matrigel morphogenesis and cell spreading.

When plated on basement membrane matrix (Matrigel), collagen, or other substrates, endothelial cells often form an anastomosing cellular network, which may be a model for angiogenesis (Vernon and Sage, 1995). The Matrigel model may not fully mimic in vivo angiogenesis or branching morphogenesis, because the network of cord-like cells contains few if any lumens (Bikfalvi et al., 1991). However, advantages of the Matrigel model are that 1) it can show dramatic morphological changes that reveal useful information about morphogenic processes; 2) it is somewhat permissive, such that a variety of nonendothelial cell types may form cord-like networks (Vernon and Sage, 1995); and 3) in general, three-dimensional models are more physiological and may often reveal much more than classical 2-dimensional cell culture models. Finally, Matrigel contains an abundance of laminin-1, thus providing an opportunity to study functions of alpha 6beta 1 integrin and associated proteins such as CD151.

    MATERIALS AND METHODS
TOP
ABSTRACT
INTRODUCTION
MATERIALS AND METHODS
RESULTS
DISCUSSION
REFERENCES

Cell Culture and CD151 Mutants and Transfectants

The NIH3T3 mouse fibroblast cell line was obtained from American Type Culture Collection (Bethesda, MD) and cultured in DMEM supplemented with 10% fetal bovine serum (FBS), penicillin, and streptomycin. CD151 mutants were generated by recombinant PCR. As a template we used wild-type human CD151 cDNA, with an HA tag linked to its C-terminus, ligated into the eukaryotic expression vector pZeoSV (Invitrogen, San Diego, CA). As shown in Figure 5, the CD151 mutants generated in this study are as follows: 1) CD151-n-A15 (N-terminal cytoplasmic domain MGEFNEKKTTCGTVCLKYLLFTY of CD151 replaced by the corresponding METKPVITCLKTLLIIYS from A15); 2) CD151-c-A15 (C-terminal cytoplasmic domain SLKLEHY of CD151 replaced with FITANQYEMV from A15); 3) CD151-nc-A15 (both N- and C-termini of CD151 replaced by corresponding domains from A15); 4) CD151-c2-NAG2 (TM4 and C-terminal tail HLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY of CD151 replaced by corresponding regions NLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA from TM4SF protein NAG-2); and 5) CD151-Delta c(GFP) (C-terminal cytoplasmic tail of CD151 LYRSLKLEHY replaced by green fluorescent protein [GFP] moiety).

For stable expression of CD151 mutants, plasmid DNAs were transfected into NIH3T3 cells using Lipofectamine (Life Technologies, Bethesda, MD). After 48 h, cells were then cultured in media containing Zeocin (200 µg/ml; Invitrogen) for selection. After 2 weeks of selection, colonies were pooled, and CD151-positive cells were sorted by flow cytometry. For double transfectants, human alpha 3 cDNA in eukaryotic expression vector pRcCMV was cotransfected (into NIH3T3 cells) with CD151 mutant plasmid DNA and selected using both G418 (1 mg/ml; Life Technologies) and Zeocin. A15/TALLA1 plasmid DNA was kindly provided by Dr. Osamu Yoshie (Kinki University, Osaka, Japan), subcloned into pRcCMV vector, and selected in G418 after stable transfection into NIH3T3 cells. To assess cell surface expression, NIH3T3 transfectants were analyzed by flow cytometry as previously described (Zhang and Hemler, 1999). Cells were incubated with negative control monoclonal antibody (mAb) and specific mAbs and then with FITC-conjugated goat anti-mouse IgG and were analyzed using a FACScan flow cytometer (Becton Dickinson, Mountain View, CA). Fluorescence with negative control mAb was subtracted to give specific mean fluorescence intensity (MFI) units.

Antibodies and Other Proteins

mAbs used in this study were anti-human CD151 mAbs 5C11 (Yauch et al., 1998) and 1A5 (Testa et al., 1999; provided by Dr. J Testa); anti-human integrin alpha 3 subunit IIF5 (Weitzman et al., 1993), anti-human CD147 mAb 8G6 (Berditchevski et al., 1997), anti-human integrin alpha V subunit mAb P3G8 (Wayner et al., 1991), anti-mouse CD9 mAb KMC8 (PharMingen, San Diego, CA), anti-mouse integrin alpha 6 subunit mAb GoH3 (PharMingen), anti-mouse CD44 mAb KM114 (PharMingen), and negative control mAb P3 (Lemke et al., 1978). A15 mAbs B2D and A2 M 30.3 were kindly provided by Dr. Osamu Yoshie (Kinki University, Osaka, Japan) and Dr. F. Lanza (Strasbourg, France), respectively. The rabbit polyclonal antibody 6843, against alpha 6A integrin cytoplasmic domain, was a gift from Dr. V. Quaranta (The Scripps Research Institute, La Jolla, CA). Horseradish peroxidase (HRP)-conjugated goat anti-mouse and goat anti-rabbit secondary antibodies (Sigma, St. Louis, MO) were also used. Matrigel, a solubilized basement membrane matrix extracted from the Engelbreth-Holm-Swarm (EHS) mouse sarcoma, was purchased from BD Bioscience (Bedford, MA). Other ECM proteins used in this study were human plasma fibronectin (Life Technologies), and mouse laminin 1 (Life Technologies). PDGF-BB was from BD Bioscience, and bFGF was from Roche Molecular Biochemicals, Indianapolis, IN.

In Vitro Morphogenesis Assay

The spontaneous formation of interconnecting web-like structures by NIH3T3 or HUVEC cells on Matrigel was used to assess morphogenic potential. Matrigel was plated into 24-well plates (0.4 ml/well) and allowed to solidify for 2 h at 37°C. NIH3T3 or HUVEC cells were then seeded into each well at a concentration of 1 × 105 cells/well in a 0.6 ml volume of DMEM. The final concentration of fetal calf serum was 5%. Cells on Matrigel were cultured at 37°C in 10% CO2 and photographed after ~8, 10, or 24 h or 7 d, as indicated. Images were captured using Scion Image 1.60 (Scion Corp.. Frederick, MD) software through a video camera (TM-7AS; PULNiX America, Inc., Sunnyvale, CA) attached to an inverted phase contrast microscope. All results were obtained in at least two independent experiments.

Immunoprecipitation and Western Blot

Immuoprecipitations were carried out as described (Zhang and Hemler, 1999). Briefly, NIH3T3 transfectants were lysed in 1% Brij 99 lysis buffer (containing 150 mM NaCl, 25 mM HEPES, 2 mM phenylmethylsulfonylfluoride, 20 µg/ml leupeptin, 20 µg/ml aprotinin, 2 mM sodium vanadate, and 2 mM sodium fluoride), at 4°C for 1 h. Lysates were preincubated (2 times) with a combination of protein A- and protein G-Sepharose beads (Pharmacia Amersham Biotech, Uppsala, Sweden) at 4°C and each time were clarified by centrifugation at 10,000 rpm centrifugation. Next, mAb preabsorbed protein A- and protein G-Sepharose beads were incubated with cell lysate at 4°C overnight. Beads were washed with 1% Brij 99 lysis buffer three times, dissolved in Laemmli sample buffer and heated at 95°C for 5 min, and then proteins were resolved by 10% SDS-PAGE. After electrophoretic transfer, nitrocellulose membranes (Schleicher & Schuell, Keene, NH) were sequentially blotted with primary antibody and HRP-conjugated anti-mouse IgG (Sigma) and then visualized with chemiluminescence reagent (New England Nuclear Life Science, Boston, MA).

DIC Time-lapse Video Microscopy

As described elsewhere (Zhang et al., 2001a, 2001b), acid-washed glass coverslips were affixed to a 60-mm Petri dish, covering a 12-mm hole. Coverslips were coated 2 h at 37°C with 100 µl Matrigel. Immediately before image acquisition, NIH3T3 transfectants were detached with 2 mM EDTA in PBS, washed once with PBS, and plated onto coverslips in complete DMEM medium. Image acquisition was achieved using a Zeiss Axiovert 135 microscope (Thornwood, NY) with a VS25 shutter controlled by a Uniblitz D122 driver (Vincent Associates, Rochester, NY) and a video camera (TM-7AS; PULNiX America, Inc.) connected to a Power Macintosh 6500 equipped with a VG-5 frame grabber (Scion Corp., Frederick, MD) through a focusing monitor (PVM-137; Sony Corp., Parkridge, NJ). A macro written for Scion Image 1.60 (Scion Corp.) controlled the shutter driver and image acquisition. Images were captured every 5 min for 13 h, as cells were maintained in a humidified, 37°C, 10% CO2 environment in a custom-built stage incubator. DIC images were obtained using a Hoffman Modulation Contrast system (Modulation Optics Inc., Greenvale, NY) consisting of a contrast objective, a condenser, and a contrast control polarizer.

    RESULTS
TOP
ABSTRACT
INTRODUCTION
MATERIALS AND METHODS
RESULTS
DISCUSSION
REFERENCES

CD151-alpha 6beta 1-dependent Network of Cord-like NIH3T3 Cell Structures on Matrigel

Upon plating on basement membrane Matrigel, NIH3T3 cells assembled into a network of cord-like structures visible after 8 h (Figure 1A) and 30 h (Figure 1B). The process began at ~5 h after cell plating, and the cord-like network pattern sometimes lasted more than 7 days (Figure 1C), depending on the batch of Matrigel. Typically, 1-1.5 × 105 cells (in area = 2 cm2) were sufficient to yield cord-like structures, whereas 5 × 104 cells was often insufficient. Cell network formation was diminished in the absence of serum but was strongly promoted in the presence of either PDGF-BB (40 ng/ml) or bFGF (40 ng/ml). For time-lapse images of cellular network formation and accompanying video, see Figure 5A, below.




View larger version (399K):
[in this window]
[in a new window]
 
Figure 1.   NIH3T3 cells form cord-like structures when plated on Matrigel. (A) Mock or human C0151-NIH3T3 cell CD151-NIH3T3 cell transfectants were grown in 5% FBS-DMEM on the surface of Matrigel for 8 h and then photographed. Monoclonal antibodies to mouse alpha 6 integrin (GoH3), and human CD151 (1A5) were added at 5 µg/ml at the beginning of the experiment. CD151 was well expressed on the surface of NIH3T3-CD151 cells (~100 MFI units, see Figure 4). (B) Cells were grown as in A but for 30 h. (C) NIH3T3-CD151-alpha 3 double-transfected cells were grown in 5% FBS-DMEM on the surface of Matrigel for 7 d and then photographed. Monoclonal antibodies to mouse alpha 6 integrin, human alpha 3 integrin (IIF5), human CD151 (5C11), mouse CD9 (KMC9), and mouse CD44 (KM114) were each added at 10 µg/ml at the beginning of the experiment. Levels of transfected alpha 3 (~55 MFI) were somewhat higher than that of endogenous alpha 6 (~26 MFI). As seen elsewhere, CD44 (Kawano et al., 2000) and CD9 (unpublished data) are highly expressed on the surface of NIH3T3 cells. Magnification, ×10.

Because a major component of Matrigel is laminin-1, we considered that integrin alpha 6beta 1 (alpha 6beta 4 is not present in NIH3T3 cells) and associated CD151 may be involved in network formation. Indeed, anti-murine alpha 6 function-blocking mAb GoH3 dramatically inhibited the 8 h (Figure 1A) and 30 h (Figure 1B) formation of cord-like structures by NIH3T3-pZeo mock transfectants. Network formation by NIH3T3-CD151 wt cells (transfected with wild-type human CD151) was inhibited not only by anti-alpha 6 mAb GoH3 but also by anti-CD151 mAb 1A5 (Figure 1, A and B). Semiquantitative RT-PCR revealed that transfected human CD151 was present at a level two- to threefold greater than endogenous murine CD151. In the absence of human CD151, mAb 1A5 was not inhibitory (Figure 1, A and B, bottom left panels). In a separate experiment, after 7 d in culture, NIH3T3-CD151-alpha 3beta 1 cotransfectants showed again a dramatic inhibition of cord-like networks by anti-alpha 6 and anti-CD151 antibodies (Figure 1C). In contrast, antibodies to CD44, to another tetraspanin protein (CD9), or to alpha 3 integrin had minimal effect after 7 d (Figure 1C) or after 30 h (our unpublished results), even though each of those molecules was present in these NIH3T3 cells at a level higher than either endogenous alpha 6beta 1 integrin or transfected CD151.

As seen elsewhere, CD151 may physically associate with alpha 6beta 1 integrin (Serru et al., 1999). To test for CD151-alpha 6 integrin complex formation in NIH3T3 cells, cells were lysed, and then human CD151 immunoprecipitates were blotted for integrin alpha 6 subunit. Levels of alpha 6 associated with human CD151 (Figure 2, lane d) were comparable to the levels of total detectable alpha 6 (lanes a and c), thus indicating a high stoichiometry interaction. These results are consistent with human CD151 being more prevalent than endogenous murine CD151 (which would also be expected to associate with alpha 6 integrin). In a control experiment, anti-CD151 antibody failed to coimmunoprecipitate alpha 6 from cells that did not contain human CD151 (lane b). Immunoprecipitation of the A15 tetraspanin protein yielded minimal associated alpha 6 integrin (lane h), even though both the alpha 6 integrin (lane g) and the A15 molecule (see Figure 4, below) were well expressed in NIH3T3-A15 transfectants. Exchange of the CD151 C-terminal cytoplasmic tails with the tail of A15 (see Figure 4 below) did not result in loss of alpha 6 association (lane f). Thus, specificity for alpha 6 association does not reside in the cytoplasmic tails of CD151. Importantly, expression of endogenous alpha 6 was not perturbed upon transfection of mutant or wild-type CD151 (Figure 2, lanes a, c, and e) and as seen by flow cytometry.


View larger version (47K):
[in this window]
[in a new window]
 
Figure 2.   Association of wild-type and mutant CD151 with alpha 6 integrin. NIH3T3 transfectants were lysed in 1% Brij 99, and then immunoprecipitations were carried out using anti-human CD151 mAb 5C11 (lanes b, d, and f), anti-human A15 mAb A2 M 30.3 (lane h), and anti-mouse alpha 6 integrin mAb GoH3 (lanes a, c, e, and g). Proteins were resolved by nonreducing 10% SDS-PAGE and blotted with anti-alpha 6 integrin polyclonal antibody 6843. The arrow indicates the position of the integrin alpha 6 subunit. Expression levels for wild-type and mutant CD151 are indicated in Figure 4 below.

CD151 C-terminal Tail Involvement

Next we discovered that the C-terminal tail of CD151 is clearly involved during CD151-alpha 6beta 1-dependent network formation. A tail exchange mutation (CD151-c-A15) caused an almost complete loss of cellular network formation (Figure 3) without altering integrin association (see Figure 2 above). In contrast, the N-terminal tail exchange mutation (CD151-n-A15) had no discernible effect, whereas exchange of both tails (CD151-nc-A15) did again abolish the cord-like structures. Expression of wt A15 itself had no effect. To confirm the role of CD151 C-terminal tail of CD151, additional mutants were generated, including another exchange mutant (CD151-c-NAG2) and a deletion mutant (CD151-Delta c-GFP). Again, CD151-dependent network formation among NIH3T3 cells was essentially abolished (Figure 3, bottom panels). Wild-type CD151, A15, and the various mutants were all stably expressed at comparable levels on the surface of NIH-3T3 cells (Figure 4). Surface expression of the CD151-Delta c-GFP mutant was not analyzed by flow cytometry using FITC-conjugated second antibody (due to excessive GFP fluorescence) but instead was confirmed by immunoprecipitation (our unpublished results). Mutant human CD151 molecules were each present at levels two- to threefold greater than endogenous murine CD151, as indicated by semiquantitative RT-PCR.


View larger version (99K):
[in this window]
[in a new window]
 
Figure 3.   Role of the CD151 C-terminal cytoplasmic domain during morphogenesis on Matrigel. The indicated transfectants were cultured in 5% FBS-DMEM on the surface of Matrigel for 24 h. Magnification, ×10. Wild-type CD151 and all mutant CD151 proteins were expressed at comparable levels (see Figure 4).


View larger version (42K):
[in this window]
[in a new window]
 
Figure 4.   Cell surface expression of wild-type and mutant CD151 in NIH3T3 cells. Stable NIH3T3 transfectants were stained with negative control mAb P3 (dashed line), anti-human A15 mAb B2D (A15-wt transfectants) or anti-human CD151 mAb 5C11 (for all other transfectants, including mock) and analyzed by flow cytometry. Schematic diagrams indicate regions from CD151 (black), A15 (gray), NAG2 (hatched), and green fluorescent protein (oval).

In a time-lapse video microscopy study, wild-type CD151 transfectants initially showed a directional migration and alignment of cells. Next, there was cell-cell contact among aligned cells, and finally the cells merged into elongated rod-like structures, before condensing into thicker cellular cables (Figure 5A and attached video). In sharp contrast, CD151-c-A15 cells were relatively motile but showed no directional cell migration and no cell-cell alignment (Figure 5B and attached video).


View larger version (119K):
[in this window]
[in a new window]
 
Figure 5.   Time lapse formation of reticular structures. (A) NIH3T3-CD151 wild-type cells were grown on Matrigel for 7 h, and photos were obtained from the same randomly chosen field at hourly intervals. (B) The same experiment was carried out using NIH3T3-CD151-c-A15 cells. Bar, 100 µM. (A video supplement to this figure was prepared from images recorded at 5-min intervals, over a period of 13 h).

CD151 C-terminal Tail-spreading Functions

We hypothesized that within a functional CD151-alpha 6beta 1 complex, effects of CD151 tail mutation should be best seen when alpha 6beta 1 is engaged with ligand. To address this, we carried out cell-spreading assays on laminin-1 (to engage alpha 6beta 1) and on fibronectin (to engage alpha 5beta 1). As shown in Figure 6A, a high percentage of all NIH3T3 transfectants showed abundant spreading after a 30-min incubation on fibronectin. On laminin 1, the majority of mock, CD151 wild-type, and A15 transfectants were well spread after 30 min, but the CD151-c-A15 mutant showed severely impaired spreading. Photographs of representative spread cells are presented in Figure 6B. Cell spreading on laminin-1 and a coating of Matrigel yielded comparable results (Figure 6B, bottom row), consistent with laminin-1 being a major component of Matrigel. These results emphasize that functional effects of CD151 C-terminal domain mutations are obvious only when the alpha 6beta 1 integrin is engaged. Previous results illustrate that CD151 has little effect on integrin-dependent cell adhesion (Yauch et al., 1998). Consistent with this, static cell adhesion to polymerized Matrigel (at levels identical to that used in morphogenesis experiments) was not markedly different among NIH3T3 transfectants (mock, wild-type CD151, CD151-c-A15, wild-type A15). Each transfectant showed ~950-1100 adherent cells/mm2, corresponding to ~70-81% of 50,000 input cells, in a standard cell adhesion assay (Pujades et al., 1997). Consistent with the presence of laminin 1 in the Matrigel, adhesion of NIH3T3 transfectants was strongly inhibited (~80%) by anti-alpha 6 integrin antibody GoH3 (our unpublished results).



View larger version (130K):
[in this window]
[in a new window]
 
Figure 6.   Comparison of cell spreading for CD151 transfectants on laminin-1 and fibronectin. NIH3T3 transfectants were seeded onto coverslips coated with either laminin-1 or fibronectin. (A) Spread cells were readily defined as cells that had increased their surface contact area by at least two- to threefold, as they began to show a flattened morphology. Each bar represents the mean ± SD from three separate experiments. (B) Photos of spread cells are shown at ×20 magnification. Coverslips were coated with laminin (Lm, 10 µg/ml), fibronectin (Fn, 10 µg/ml), or Matrigel (Mgl, diluted 1/30 from stock solution, according to manufacturer's instructions; BD Labware, Bedford, MA). Cell spreading was carried out in serum-free DMEM at 37°C for 30 min. For cells on laminin-1, PDGF (40 ng/ml) was included to enhance spreading.

Perturbation of Endothelial Cell Structures

Early passage HUVEC cells also form a network of cord-like structures when cultured on Matrigel (Sincock et al., 1999). The appearance of these cord-like structures (Figure 7) was partially disrupted by antibodies to either CD151 (mAb 5C11), or anti-alpha 6 integrin (mAb GoH3). However, anti-CD147 mAb 8G6 and anti-alpha V integrin mAb P3G8 had no obvious effect. These results indicate that CD151-alpha 6beta 1 complexes in multiple cell types can play a critical role during morphogenesis into cellular networks on Matrigel.


View larger version (99K):
[in this window]
[in a new window]
 
Figure 7.   Perturbation of capillary-like structures formed by human endothelial cells. HUVECs were seeded on Matrigel for 24 h, in the presence of monoclonal antibodies (anti-integrin alpha 6, GoH3; anti-CD151, 5C11; anti-CD147, 8G6; anti-integrin alpha V, P3G8), each at 10 µg/ml. The CD151 and CD147 molecules and the alpha 6 and alpha V integrins are each very well expressed on HUVECs (Leukocyte Typing VI, 1998). Photos were obtained after 24 h. Magnification, ×10.

    DISCUSSION
TOP
ABSTRACT
INTRODUCTION
MATERIALS AND METHODS
RESULTS
DISCUSSION
REFERENCES

The CD151-alpha 6beta 1 Complex as a Functional Unit

CD151 formed a complex with integrin alpha 6beta 1 as shown here in NIH3T3 cells and as shown elsewhere in HUVECs and other cell types (Fitter et al., 1999; Serru et al., 1999; Sincock et al., 1999). The specificity of the CD151-alpha 6beta 1 interaction is underscored by our failure to observe A15/Talla1 tetraspanin association with alpha 6beta 1 integrin. Elsewhere, the CD151-alpha 6beta 1 interaction was highly specific and was similarly retained under conditions in which other integrin-tetraspanin interactions were disrupted (Serru et al., 1999).

Although CD151-alpha 6beta 1 complexes have been demonstrated previously, their functional relevance had not been demonstrated. Here we show that the CD151-alpha 6beta 1 complex is acting as a functional unit because CD151 C-terminal tail mutation perturbed alpha 6beta 1-dependent functions (network formation, cell spreading) only when alpha 6beta 1 was engaged (on purified laminin-1 or on Matrigel) and not when a different integrin (alpha 5beta 1) was engaged (on fibronectin). Furthermore, antibodies to both CD151 and alpha 6beta 1 strongly inhibited network formation by HUVECs (Figure 7), NIH3T3 cells, NIH3T3-alpha 3 cells (Figure 1) and by an immortalized alpha 3-deficient murine kidney epithelial cell line (Wang et al., 1999; our unpublished results).

In contrast to CD151-alpha 6beta 1 complexes, CD151-alpha 3beta 1 complexes did not influence NIH3T3 cell morphogenesis on Matrigel. Presumably, although the alpha 3beta 1 integrin may interact with laminin-1, it may not interact in the same manner or to the same extent as alpha 6beta 1. Alternatively, CD151-alpha 3beta 1 complexes may transmit different cellular signals, not conducive to network formation. Whereas anti-CD151 antibodies inhibited alpha 6beta 1 integrin-dependent function when cells were plated on laminin-1 (as shown here); elsewhere, anti-CD151 antibodies inhibited alpha 3beta 1 functions on laminin-5 but not on laminin-1 (Stipp and Hemler, 2000). Thus, CD151-alpha 6beta 1 and CD151-alpha 3beta 1 complexes are functionally distinct.

A New Dimension in Integrin Signaling

It is well established that integrin cytoplasmic domains play critical roles in determining the functional consequences of ligand binding (Liu et al., 2000). For example, integrin alpha 6 cytoplasmic domains can regulate MAP kinase activation and cell migration (Gimond et al., 1998; Wei et al., 1998). Now we demonstrate that another cytoplasmic tail, that of CD151, may be just as important for alpha 6 integrin function as integrin tails themselves. A transmembrane linker role for tetraspanins has been proposed (Hemler, 1999) because extracellular domains of tetraspanin proteins such as CD151 provide specificity for integrin association, and intracellular domains may determine association with signaling molecules such as PtdIns 4-K (Yauch and Hemler, 2000) and PKC (Zhang et al., 2001a, 2001b). Results here support the concept of TM4SF proteins as transmembrane linkers. First, a distinct region of CD151, likely extracellular and not involving the cytoplasmic tails, is needed for alpha 6beta 1 integrin association. Second, the CD151 C-terminal cytoplasmic tail makes an essential contribution to NIH3T3 morphogenesis, as evidenced by tail deletion and two different tail exchange mutations. Most likely, our CD151 C-terminal tail mutants are having a dominant negative effect on endogenous CD151. While retaining integrin association, they disrupt critical CD151 tail-dependent signaling pathways that complement alpha 6beta 1 integrin-signaling pathways. Neither integrin alpha 6beta 1 expression levels or alpha 6beta 1-dependent cell adhesion were affected by transfection of either wild-type or mutant CD151 into NIH3T3 cells. These latter results are in agreement with previous studies showing that CD151 and other tetraspanin proteins have little or no effect on cell adhesion (Hemler et al., 1996; Yauch et al., 1998). Thus, our dominant negative CD151 is altering outside-in rather than inside-out integrin signaling.

Among tetraspanin proteins, there has been little precedent for cytoplasmic domains having clear functional relevance. Now we demonstrate that the CD151 C-terminal tail is clearly distinct from the A15 and NAG2 tails with respect to its influence on cell network formation. With the CD151 tail having only ~9 residues, it should be readily feasible to identify the critical individual amino acids in future studies. It remains to be demonstrated whether the CD151 C-terminal tail may also play a critical role in the functioning of CD151-alpha 6beta 4 complexes in hemidesmosomes (Sterk et al., 2000) or in CD151-alpha 3beta 1 complexes during neurite outgrowth (Stipp et al., 2001) and in cell migration (Yauch et al., 1998).

Formation of Cord-like Networks on Matrigel

Several cell types may form cord-like networks on a variety of different extracellular matrices (Vernon and Sage, 1995). Although the role of integrins (including alpha 6beta 1) during network formation has been well established (Bauer et al., 1992; Berdichevsky et al., 1994; Davis and Camarillo, 1995; Vernon and Sage, 1995; Stahl et al., 1997; Sun et al., 1998), a major role for a tetraspanin protein has not previously been observed. In a prior study of endothelial cells on Matrigel, anti-CD151 antibody inhibition effects were more subtle than shown here, perhaps because of the use of different antibodies (Sincock et al., 1999).

In several previous studies, formation of cord-like structures on Matrigel has been seen as an in vitro model of angiogenesis. Indeed, our antibody inhibition results seen in NIH3T3 cells were confirmed using HUVECs, thus suggesting that CD151 may contribute to angiogenesis in particular and to branching morphogenesis in general. For fibroblasts in particular, a network of cord formation on Matrigel may be a model also for wound healing and development (Vernon and Sage, 1995). On Matrigel, cells that exert mechanical traction forces on the matrix may then align along "matrix guidance pathways" to form cord-like structures (Davis and Camarillo, 1995; Vernon and Sage, 1995).

Our time-lapse video results suggest that CD151-dependent NIH3T3 cell morphogenesis has at least three phases: cellular alignment due to tractional forces, cell motility, and cell-cell contact. It remains to be determined which of these phases is specifically facilitated by CD151. CD151 could play a key role at cell-cell contact sites (Yánez-Mó et al., 1998; Sincock et al., 1999). However, because CD151 effects on cell alignment and migration precede cell-cell contact, that seems unlikely. Instead, CD151 may promote cell movement, because tetraspanin proteins in general and CD151 in particular are well established as regulators of cell motility (Hemler et al., 1996; Maecker et al., 1997; Yauch et al., 1998). Also, CD151 may promote mechanical traction-related forces. Consistent with this, CD151 tail mutation abolished cell spreading, another event requiring tractional forces.

In conclusion, our results provide perhaps the best support to date for a tetraspanin protein (CD151) having a transmembrane linker function. The extracellular portion associates with the integrin, whereas the cytoplasmic tail determines the specific consequences of integrin outside-in signaling (without altering cell adhesion). We suggest that while alpha 6beta 1 is interacting with laminin-1, alpha 6beta 1-associated CD151 is optimally localized to promote cell alignment with mechanical traction forces, cell motility, cell spreading, and/or other events needed for NIH3T3 cell morphogenesis into a cellular reticulum. This points to a new functional role for CD151. Finally, CD151 and alpha 6beta 1 integrin also play critical roles during endothelial cell morphogenesis, illustrating the generality of our findings.

    ACKNOWLEDGMENTS

This work was supported by National Institutes of Health grants CA86712 and CA42368 (to M.E.H).

    FOOTNOTES

Dagger Corresponding author. E-mail address: martin_hemler{at}dfci.harvard.edu.

* Present address: Vascular Biology Center, University of Tennessee Health Science Center, Memphis, TN 38163.

dagger These authors made equal contributions.

Article published online ahead of print. Mol. Biol. Cell 10.1091/mbc.01-10-0481. Article and publication date are found at www.molbiolcell.org/cgi/doi/10.1091/mbc.01-10-0481.

    ABBREVIATIONS

Abbreviations used: DIC, differential interference contrast; ECM, extracellular matrix; HUVEC, human umbilical vein endothelial cells; TM4SF, transmembrane 4 superfamily.

    REFERENCES
TOP
ABSTRACT
INTRODUCTION
MATERIALS AND METHODS
RESULTS
DISCUSSION
REFERENCES


Molecular Biology of the Cell
Vol. 13, 1-11, January 2002
Copyright © 2002 by The American Society for Cell Biology



This article has been cited by other articles:


Home page
Cardiovasc ResHome page
F. Zhang, J. Kotha, L. K. Jennings, and X. A. Zhang
Tetraspanins and vascular functions
Cardiovasc Res, July 1, 2009; 83(1): 7 - 15.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
L. Liu, B. He, W. M. Liu, D. Zhou, J. V. Cox, and X. A. Zhang
Tetraspanin CD151 Promotes Cell Migration by Regulating Integrin Trafficking
J. Biol. Chem., October 26, 2007; 282(43): 31631 - 31642.
[Abstract] [Full Text] [PDF]


Home page
BloodHome page
Y. Takeda, A. R. Kazarov, C. E. Butterfield, B. D. Hopkins, L. E. Benjamin, A. Kaipainen, and M. E. Hemler
Deletion of tetraspanin Cd151 results in decreased pathologic angiogenesis in vivo and in vitro
Blood, February 15, 2007; 109(4): 1524 - 1532.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
I.-K. Hong, Y.-J. Jin, H.-J. Byun, D.-I. Jeoung, Y.-M. Kim, and H. Lee
Homophilic Interactions of Tetraspanin CD151 Up-regulate Motility and Matrix Metalloproteinase-9 Expression of Human Melanoma Cells through Adhesion-dependent c-Jun Activation Signaling Pathways
J. Biol. Chem., August 25, 2006; 281(34): 24279 - 24292.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
S. Gesierich, I. Berezovskiy, E. Ryschich, and M. Zoller
Systemic Induction of the Angiogenesis Switch by the Tetraspanin D6.1A/CO-029.
Cancer Res., July 15, 2006; 66(14): 7083 - 7094.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
M. Sala-Valdes, A. Ursa, S. Charrin, E. Rubinstein, M. E. Hemler, F. Sanchez-Madrid, and M. Yanez-Mo
EWI-2 and EWI-F Link the Tetraspanin Web to the Actin Cytoskeleton through Their Direct Association with Ezrin-Radixin-Moesin Proteins
J. Biol. Chem., July 14, 2006; 281(28): 19665 - 19675.
[Abstract] [Full Text] [PDF]


Home page
Mol. Biol. CellHome page
N. E. Winterwood, A. Varzavand, M. N. Meland, L. K. Ashman, and C. S. Stipp
A Critical Role for Tetraspanin CD151 in {alpha}3beta1 and {alpha}6beta4 Integrin-dependent Tumor Cell Functions on Laminin-5
Mol. Biol. Cell, June 1, 2006; 17(6): 2707 - 2721.
[Abstract] [Full Text] [PDF]


Home page
J. Cell Sci.Home page
A. Ziyyat, E. Rubinstein, F. Monier-Gavelle, V. Barraud, O. Kulski, M. Prenant, C. Boucheix, M. Bomsel, and J.-P. Wolf
CD9 controls the formation of clusters that contain tetraspanins and the integrin {alpha}6{beta}1, which are involved in human and mouse gamete fusion
J. Cell Sci., February 1, 2006; 119(3): 416 - 424.
[Abstract] [Full Text] [PDF]


Home page
Circ. Res.Home page
G. E. Davis and D. R. Senger
Endothelial Extracellular Matrix: Biosynthesis, Remodeling, and Functions During Vascular Morphogenesis and Neovessel Stabilization
Circ. Res., November 25, 2005; 97(11): 1093 - 1107.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
B. He, L. Liu, G. A. Cook, S. Grgurevich, L. K. Jennings, and X. A. Zhang
Tetraspanin CD82 Attenuates Cellular Morphogenesis through Down-regulating Integrin {alpha}6-Mediated Cell Adhesion
J. Biol. Chem., February 4, 2005; 280(5): 3346 - 3354.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
J. Lammerding, A. R. Kazarov, H. Huang, R. T. Lee, and M. E. Hemler
Tetraspanin CD151 regulates {alpha}6{beta}1 integrin adhesion strengthening
PNAS, June 24, 2003; 100(13): 7616 - 7621.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
M. D. Gutierrez-Lopez, S. Ovalle, M. Yanez-Mo, N. Sanchez-Sanchez, E. Rubinstein, N. Olmo, M. A. Lizarbe, F. Sanchez-Madrid, and C. Cabanas
A Functionally Relevant Conformational Epitope on the CD9 Tetraspanin Depends on the Association with Activated beta 1 Integrin
J. Biol. Chem., January 3, 2003; 278(1): 208 - 218.
[Abstract] [Full Text] [PDF]


Home page
JCBHome page
A. R. Kazarov, X. Yang, C. S. Stipp, B. Sehgal, and M. E. Hemler
An extracellular site on tetraspanin CD151 determines {alpha}3 and {alpha}6 integrin-dependent cellular morphology
J. Cell Biol., September 29, 2002; 158(7): 1299 - 1309.
[Abstract] [Full Text] [PDF]


Home page
Mol. Biol. CellHome page
X. Yang, C. Claas, S.-K. Kraeft, L. B. Chen, Z. Wang, J. A. Kreidberg, and M. E. Hemler
Palmitoylation of Tetraspanin Proteins: Modulation of CD151 Lateral Interactions, Subcellular Distribution, and Integrin-dependent Cell Morphology
Mol. Biol. Cell, March 1, 2002; 13(3): 767 - 781.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow A correction has been published
Right arrow All Versions of this Article:
01-10-0481v1
13/1/1    most recent
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Zhang, X. A.
Right arrow Articles by Hemler, M. E.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Zhang, X. A.
Right arrow Articles by Hemler, M. E.


Home Help [Feedback] [For Subscribers] [Archive] [Search] [Contents]