![]() |
|
|
Vol. 17, Issue 4, 1549-1558, April 2006
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||

* Institute of Biochemistry I, Faculty of Medicine, Johann Wolfgang Goethe-University Frankfurt, 60590 Frankfurt, Germany;
Department of Chemical Biology, German Research Center for Biotechnology, 38124 Braunschweig, Germany
Submitted August 17, 2005;
Revised December 27, 2005;
Accepted January 10, 2006
Monitoring Editor: Suzanne Pfeffer
| ABSTRACT |
|---|
|
|
|---|
requires association of the von Hippel Lindau protein (pVHL) to provoke ubiquitination followed by proteasomal digestion. Besides hypoxia, nitric oxide (NO) stabilizes HIF-1
under normoxia but destabilizes the protein under hypoxia. To understand the role of NO under hypoxia we made use of pVHL-deficient renal carcinoma cells (RCC4) that show a high steady state HIF-1
expression under normoxia. Exposing RCC4 cells to hypoxia in combination with the NO donor DETA-NO (2,2'-(hydroxynitrosohydrazono) bis-ethanimine), but not hypoxia or DETA-NO alone, decreased HIF-1
protein and attenuated HIF-1 transactivation. Mechanistically, we noticed a role of calpain because calpain inhibitors reversed HIF-1
degradation. Furthermore, chelating intracellular calcium attenuated HIF-1
destruction by hypoxia/DETA-NO, whereas a calcium increase was sufficient to lower the amount of HIF-1
even under normoxia. An active role of calpain in lowering HIF-1
amount was also evident in pVHL-containing human embryonic kidney cells when the calcium pump inhibitor thapsigargin reduced HIF-1
that was stabilized by the prolyl hydroxylase inhibitor dimethyloxalylglycine (DMOG). We conclude that calcium contributes to HIF-1
destruction involving the calpain system. | INTRODUCTION |
|---|
|
|
|---|
subunit and the 91-94-kDa HIF-1
subunit (Semenza and Wang, 1992
is constitutively expressed, oxygen facilitates continues destruction of HIF-1
via the 26S proteasome. This requires polyubiquitination by an E3-ubiquitin ligase complex that contains the von Hippel Lindau protein (pVHL; Kaelin, 2002
demands hydroxylation of Pro564 and/or Pro402 within the oxygen-dependent degradation domain (ODD) of HIF-1
(Ivan et al., 2001
protein stability, oxygen affects the transcriptional activity of HIF-1, by regulating hydroxylation of a critical Asn803 residue within the C-terminal transactivation domain (CTAD) of HIF-1
(Lando et al., 2002
Signals other than hypoxia such as nitric oxide (NO) and/or reactive nitrogen intermediates (RNI) participate in hypoxic signaling (Kimura et al., 2000
; Palmer et al., 2000
; Sandau et al., 2001
; Thomas et al., 2004
). Under normoxia, RNI evoke HIF-1
stabilization and formation of the active HIF-1 dimer to mimic a hypoxic response. These observations are compatible with the notion that RNI block PHD-activity. Thus, attenuating proline hydroxylation of HIF-1
hinders association with pVHL with the consequence of protein accumulation due to decreased ubiquitination/proteasomal degradation (Metzen et al., 2003
). Opposite results are observed when RNI are generated under hypoxic conditions. RNI attenuate hypoxia-induced HIF-1
accumulation, HIF-1 DNA-binding and HIF-1 transcriptional activation (Liu et al., 1998
; Sogawa et al., 1998
; Huang et al., 1999
). Although mechanistic details remained unclear it has been proposed that NO, derived from sodium nitroprusside, enhanced the interaction between HIF-1
and pVHL in vitro through reactivation of PHD activity (Wang et al., 2002
). More recently it was proposed that NO, by blocking cytochrome c oxidase, leaves more oxygen available for PHD to regain its activity under hypoxic conditions (Hagen et al., 2003
). Alternatively, reactive oxygen species including ONOO may contribute to destabilize HIF-1
under hypoxia by mechanisms yet to be identified (Agani et al., 2002
; Wellman et al., 2004
).
We approached the question of RNI action in destabilizing HIF-1
by using renal cell carcinoma (RCC4) cells which are pVHL deficient and therefore permanently express HIF-1
and show active HIF-1. In RCC4 cells the combination of hypoxia and the NO donor DETA-NO lowered HIF-1
expression and HIF-1 activity by activating the calpain system without affecting transcription and translation of HIF-1
. The role of calpain in HIF-1
destruction was verified by applying calpain inhibitors, showing calcium dependencies and observing a direct binding of calpain to HIF-1
. Moreover, we provide evidence that calpain operates in pVHL-containing human embryonic kidney (HEK293) cells as well. We conclude that calcium and calpains participate in regulating HIF-1
expression and thus modulate responses toward hypoxia.
| MATERIALS AND METHODS |
|---|
|
|
|---|
(IFN
) and protease inhibitor cocktail came from Roche (Mannheim, Germany). Nitrocellulose membrane, ECL detection system and horseradish peroxidase (HRP)-labeled anti-mouse or anti-rabbit secondary antibodies were delivered by Amersham Biosciences (Freiburg, Germany). Anti-HIF-1
antibody and Clontech Advantage RT-for-PCR kit were purchased from Becton Dickinson (Heidelberg, Germany). Anti-I
B
antibody was bought from Santa Cruz (Heidelberg, Germany), the anti-HA monoclonal antibody came from CRP (Denver, CO), anti-calpain-1 antibody was delivered by Biomol (Hamburg, Germany) and anti-mouse-DynaBeads were purchased from Invitrogen (Karlsruhe, Germany). Primers were ordered from MWG-Biotech (Ebersberg, Germany). The plasmid pHA-HIF-1
encoding HA-tagged-HIF-1
was kindly provided by Dr. P. J. Ratcliffe (Institute of Molecular Medicine, John Radcliffe Hospital, Oxford, United Kingdom). The plasmid pGLEPOHRE harboring three erythropoietin hypoxia-responsive elements (HRE) was from Dr. T. Kietzmann (University of Kaiserslautern, Kaiserslautern, Germany). Reporter plasmid cap-Luc and luciferase activity assay kit were supplied by Promega (Mannheim, Germany).
Cell Culture
Renal cell carcinoma (RCC4), RCC4 cells with pVHL being reintroduced (RCC4/VHL) and human embryonic kidney 293 (HEK293) cells were cultured in DMEM with 4.5 g/l glucose, supplemented with 2 mM glutamine, 100 U/ml penicillin, 100 µg/ml streptomycin, 1 mM sodium pyruvate, and 10% FCS. Cells were kept at 37°C in a humidified atmosphere with 5% CO2. For hypoxic exposure, cells were incubated at 0.5% O2 in a hypoxia workstation (Ruskinn Technology, Leeds, United Kingdom).
Western Blotting
RCC4 cells, 5 x 105, were seeded in 6-cm dishes 1 d before experiments. After treatments, cells were scraped off, lysed in 150 µl buffer A (50 mM Tris/HCl, 150 mM NaCl, 5 mM EDTA, 0.5% Nonidet-40, protease inhibitor cocktail, pH 7.5), and sonicated. After centrifugation (15000 x g, 15 min) the protein content was determined in the supernatants by a protein assay kit (Bio-Rad, Munich, Germany) and 80 µg protein was added to the same volume of 2x SDS-PAGE sample buffer (125 mM Tris/HCl, 2% SDS, 10% glycerin, 1 mM DTT, 0002% bromophenol blue, pH 6.9) and boiled for 5 min. Proteins were resolved on 10% SDS-polyacrylamide gels and blotted onto nitrocellulose membranes. Nonspecific binding sites were blocked with 5% (wt/vol) defatted milk powder in TTBS (50 mM Tris/HCl, 140 mM NaCl, 0.05% Tween-20, pH 7.2) for 1 h. The HIF-1
, actin and I
B
antibodies (1:1000 in 1% milk/TTBS) were added and incubated overnight at 4°C. Afterward, nitrocellulose membranes were washed three times for 5 min each with TTBS. Blots were then incubated with goat anti-mouse or goat anti-rabbit secondary antibodies conjugated with HRP (1:2000 in 1% milk/TTBS) for 1 h and washed three times for 5 min each with TTBS, followed by ECL detection.
Quantitative Real-Time RT-PCR
RCC4 cells, 2 x 106, were seeded in 10-cm dishes 1 d before experiments. The following day medium was changed and cells were treated as indicated. Total RNA was isolated using the peqGOLD RNAPure kit (Peqlab, Erlangen, Germany). The reverse transcription was completed with a Clontech Advantage RT-for-PCR kit using hexamer random primers. The following primer pairs were selected for quantitative real-time PCR: human HIF-1
forward: 5'-CTCAAAGTCGGACAGCCTCA-3'; human HIF-1
backward: 5'-CCCTGCAGTAGGTTTCTGCT-3'; human actin forward: 5'-TGACGGGGTCACCCACACTGTGCCCATCTA-3'; and human actin backward: 5'-CTAGAAGCATTTGCGGTCGACGATGGAGGG-3'.
|
were then normalized to the relative amounts of actin.
Cell Transfection and Reporter Assay
RCC4 cells, 2 x 105, were seeded in 6-cm dishes 1 d before transfection. At a rate of 60% confluence, cells were transfected with reporter plasmids or pHA-HIF-1
, using the Polyfect transfection reagent (Qiagen, Hilden, Germany) according to instructions of the manufacturer. Sixteen hours later medium was changed and incubations continued for another 8-h period. For reporter assays the medium was replaced and cells were treated as indicated for an additional 16-h period. Cells were lysed and luciferase activity was measured. Relative values of treated cells were calculated by normalizing to values of control cells (set as 100). For HA-HIF-1
expression, cells were treated for 4 h as indicated.
|
peptide spots was generated after SPOT synthesis. Briefly, 272 overlapping peptide fragments of 15 amino acids in length with an offset of 3 amino acid residues were generated such that the complete HIF-1
protein sequence was covered. These HIF-1
peptides were chemically synthesized as an array of spots on an aminopegylated cellulose membrane as described previously (Frank and Overwin, 1996
peptide array was stripped as described by Frank and Overwin (1996
|
Calpain Coimmunoprecipitation
antibody, and incubated at 4°C for 1 h. Thereafter, 20 µl anti-mouse-DynaBeads were added and incubations continued at 4°C overnight. Beads were collected, washed three times with 100 µl buffer C, and finally supplemented with 50 µl 2x SDS-PAGE sample buffer and boiled at 95°C for 10 min. Beads were removed by centrifugation and supernatants were loaded on 7.5% SDS-PAGE. Western blot analysis was performed using calpain-1 or anti-HIF-1
antibodies.
Densitometric Quantification
Densitometric quantification (expressed as quantum levels) of HIF-1
and I
B
signals was performed with the Aida Image Software (Raytest Isotopenmessgeraete GmbH, Straubenhardt, Germany). Relative intensities were calculated from the Quantum levels ratios of HIF/I
B
by setting controls as 100.
Statistical Analysis
Each experiment was performed at least three times and representative data are shown. Data in bar graphs are given as mean values ± SEM. Means were checked for statistical differences by using the Student's t test with error probabilities of p < 0.05 (*).
| RESULTS |
|---|
|
|
|---|
Accumulation
is constitutively expressed because a functional pVHL is lacking. Incubations of RCC4 cells for 4 h with 0.5 mM DETA-NO under hypoxia (0.5% O2) decreased HIF-1
protein level (Figure 1A). As controls, the expression of actin and I
B
remained constant under all treatments. Similar amounts of the housekeeping protein actin indicated equal loading of total protein to the gel. Constant expression of the rapidly turned-over I
B
implied that destruction of HIF-1
was not shared by other proteins that are degraded by the proteasome. Densitometric analysis indicated that only 24% of the HIF-1
signal remained under hypoxia/NO cotreatment compare to controls or hypoxia and/or DETA-NO added alone (Figure 1B). Destruction of HIF-1
was not seen when hypoxia or DETA-NO were supplied individually.
|
we transfected RCC4 cells with a pGLEPOHRE reporter construct and followed expression of luciferase as a marker for HIF-1 activity (Figure 1C). As expected, we measured a basal activity that was neither increased by incubating cells under hypoxic conditions nor when treating cells with the NO-liberating compound DETA-NO. However, exposing cells to the combination hypoxia/DETA-NO lowered reporter activity by roughly 40%. Control experiments, by looking for trypan blue exclusion, excluded that cell viability was affected by any treatment.
Further experiments with GSNO, an alternative NO donor, at a concentration of 1 mM, reproduced results seen with DETA-NO (Figure 2A). GSNO only decreased the amount of HIF-1
in combination with hypoxia.
To answer the question whether endogenously produced NO would suffice in lowering HIF-1
under hypoxia, we stimulated RCC4 cells with LPS/IFN
, which is known to express inducible NO-synthase in these cells. The combination of hypoxia/LPS/IFN
lowered the protein amount of HIF-1
(Figure 2B). Interestingly, blocking NO production with the NO-synthase inhibitor L-NAME restored HIF-1
expression, thus pointing to the essential role of NO in lowering protein expression of HIF-1
under hypoxia. Under normoxia the addition of LPS/IFN
left HIF-1 expression unaltered (data not shown). To confirm destruction of exogenous HIF-1
under hypoxia/NO, we overexpressed HA-tagged HIF-1
in RCC4 cells by transfecting the pHA-HIF-1
plasmid (Figure 2C). The combination of hypoxia/NO lowered the amount of exogenous HIF-1
protein comparable to endogenous HIF-1
, whereas hypoxia or NO alone were ineffective.
Similarly, expression of HIF-2
was reduced to 35% compared with controls under the influence of hypoxia/DETA-NO (Figure 3).
Considering that expression regulation of HIF-2
and HIF-1
are very similar (Cockman et al., 2000
), we concentrated on HIF-1
only. We conclude that in combination with hypoxia exogenously supplied or endogenously generated NO reduced HIF-1
accumulation and HIF-1 activity in RCC4 cells and thus in a pVHL-independent manner.
Hypoxia/NO Promotes pVHL-independent Degradation of HIF-1
To rule out that variations in HIF-1
mRNA account for changes in HIF-1
protein under hypoxia/NO costimulation, we used quantitative real-time RT-PCR to follow HIF-1
mRNA (Figure 4A). HIF-1
mRNA remained constant and was neither affected by hypoxia or by DETA-NO given alone nor by coincubating hypoxia/DETA-NO.
With the further experiment it was our intention to check a possible interference with translational control mechanisms of HIF-1
. To this end we exposed RCC4 cells for 4 h to 50 µM cycloheximide to block protein translation (Figure 4B). Thereafter, the medium was changed to wash out cycloheximide and incubations continued for 14 h under normoxia. This allowed recovering expression of HIF-1
. We then repeated the same experimental protocol in the presence of hypoxia/DETA-NO. After cycloheximide treatment HIF-1
disappeared but its expression recovered during the next 4 h even under conditions of hypoxia/DETA-NO. However, the reappearance of HIF-1
was weaker compared with the normoxic situation. Although indirect, the experiment might suggest that translation of HIF-1
was operating even under hypoxia/DETA-NO. To gain further support, we performed reporter assays to test cap-dependent translation in general (Figure 4C). As established, we reconfirmed that translation slowed down under hypoxia and noticed that there was no further alteration under hypoxia/DETA-NO cotreatments. Despite these results not completely eliminate the possibility of HIF-1
translational regulation, they showed that the combination of hypoxia/DETA-NO did not selectively impaired translation. Taking into account that the amount of exogenous HIF-1
is lowered by hypoxia/NO as well (Figure 2C) points to protein destruction as the underlying principle. Therefore, we focused on alternative pathways to explain HIF-1
destruction.
To address the importance of HIF-1
destruction, we asked whether inhibition of protein degradation with MG132 might affect HIF-1
disappearance under conditions when hypoxia and DETA-NO were supplied simultaneously. As seen in Figure 5A, attenuated accumulation of HIF-1
as a result of hypoxia/DETA-NO treatment was fully restored in the presence of the putative proteasome inhibitor MG132. This pointed to protein degradation in lowering HIF-1
protein level in the presence of hypoxia/DETA-NO.
|
Considering MG132 as a putative proteasomal inhibitor, results might point to an alternative pVHL-like E3 ligase and hydroxylation/ubiqutination/proteasome degradation system to be involved. Therefore, we assumed that the PHD inhibitor DMOG should be equally effective compared with MG132 because DMOG is supposed to block hydroxylation of HIF-1
and thus is expected to increase stabilization of HIF-1
. However, in contrast to MG132 the addition of DMOG under conditions of hypoxia/DETA-NO did not restore HIF-1
expression (Figure 5B). These observations are consistent with the notion that RCC4 cells do not contain the usual HIF-1
degradation system because pVHL is missing. More important, these results question the specificity of MG132 as a selective proteasomal inhibitor. We then applied more specific proteasome inhibitors such as lactacystin and epoxomicin. Interestingly, none of them reversed HIF-1
destruction under hypoxia/DETA-NO (Figure 5C). As these results ruled the 26S proteasome in degrading HIF-1
out, we searched for alternative destruction pathways that might explain the disappearance of HIF-1
in RCC4 cells when exposed to hypoxia and DETA-NO.
|
Degradation
degradation. In a first approach we used two calpain inhibitors such as calpain inhibitor I (ALLN) and calpain inhibitor II (ALLM) and noticed their ability to fully restore HIF-1
stabilization that was compromised under the cotreatment of hypoxia/DETA-NO (Figure 6A). ALLN and ALLM, both at 100 nM, were equally effective compared with MG132 in blocking HIF-1
degradation.
To confirm a direct role of calpain in HIF-1
degradation, we applied the specific calpain inhibitor calpastatin, a 27-residue peptide inhibitor. Calpastatin peptide indeed blocked HIF-1
destruction under hypoxia/DETA-NO (Figure 6B). From these inhibitor studies we conclude that calpain is involved in HIF-1
degradation.
The Role of Calcium in Provoking Calpain-mediated HIF-1
Degradation
To establish a modulator role of calcium in affecting HIF-1
expression, we sought to inhibit the process by chelating intracellular calcium. Incubating RCC4 cells with 1, 5, or 20 µM BAPTA-AM dose-dependently reversed the disappearance of HIF-1
that was initiated by hypoxia/DETA-NO (Figure 7A). In the presence of 20 µM BAPTA-AM the effect of hypoxia/DETA-NO was nullified, whereas the intracellular calcium chelator alone did not affect HIF-1
accumulation in RCC4 cells.
|
under normoxia. Exposing RCC4 cells for 4 h to 1 µg/ml the calcium ionophore ionomycin lowered expression of HIF-1
(Figure 7B). This effect was completely attenuated in the presence of the calpain inhibitor ALLM. Interestingly, degradation that was initiated by raising intracellular calcium with ionomycin was equally effective to the combination of hypoxia/DETA-NO in lowering the HIF-1
amount but left expression of I
B unaltered. As expected, under hypoxia ionomycin was equally effective in lowering the amount of HIF-1
(Figure 7C). In an additional experiment we have chosen the endoplasmic reticulum calcium (ER) pump inhibitor thapsigargin, known to promote a cytoplasmic calcium increase (Figure 7D). Incubating RCC4 cells under normoxia with 30 nM thapsigargin time-dependently lowered the amount HIF-1
, with the protein almost disappearing after 60 min. These results support the notion that calpain participates in regulating degradation of HIF-1
, in a pVHL-independent manner.
Calcium/Calpain-mediated HIF-1
Degradation in pVHL-containing Cells
To answer the question whether calpain-mediated degradation of HIF-1
is restricted to RCC4 cells or can be observed in other cells as well, we performed additional experiments in pVHL-containing HEK293 cells. HEK293 cells were first incubated with 1 mM DMOG for 1 h to block PHD activity and to allow HIF-1
accumulation (Figure 8A). Afterward, incubations continued for 1 h either in the presence of DMOG alone or with the further addition of 10 versus 30 nM thapsigargin. As shown in Figure 8A, DMOG-induced HIF-1
accumulation was dose-dependently reduced by thapsigargin. Thapsigargin alone neither time- nor concentration-dependently accumulated HIF-1
(data not shown).
|
and restored expression of the protein close to a value seen with DMOG alone (Figure 8, B and C). As expected, the specific proteasome inhibitor lactacystin was unable to reverse HIF-1
destruction (Figure 8C). To match the RCC4 cell background, RCC4/VHL cells, which contain a stably reintroduced pVHL expression plasmid, were applied as a pVHL-containing cell to repeat experiments. DMOG accumulated HIF-1
in RCC4/VHL cells (Figure 8D). HIF-1
disappeared when cells were treated with thapsigargin and reappeared with the presence of calpastatin but not lactacystin. These results strengthen a role of calpain-mediated HIF-1
degradation.
Interaction between HIF-1
and Calpain-1
To provide complementary evidence to show an interaction between HIF-1
and calpain, we used a HIF-1
peptide spot array. The membrane was incubated with human calpain-1, followed by anti-calpain-1 antibody detection (Figure 9A).
|
with the sequences: 001MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYE039, 151RNGLVKKGKEQNTQRSFFLRMKCTLTS177, 658PYRDTQSRTASPNRAGKGVIE678, and 712ALQNAQRKRKMEHDGSLFQAV732. One should keep in mind that these potential calpain-1 binding sites not necessarily overlap with cleavage sites, especially as the binding assay has been performed with an inactive calpain enzyme, i.e., with the presence of EGTA. To further investigate the interaction between HIF-1
and calpain under cellular conditions, we used cell lysate of RCC4 cells either kept under normoxia or hypoxia/DETA-NO to perform coimmunoprecipitations using an anti-HIF-1
antibody for precipitation, followed by detection of calpain-1 (Figure 9B). Evidently, calpain bound to HIF-1
under normoxic and hypoxia/DETA-NO conditions. Control experiments leaving out the HIF-1
antibody used for immunoprecipitation revealed no unspecific binding of calpain-1 to the beads (data not shown). It should be mentioned that for these experiments calpain-1 activity again was blocked by using EGTA. Based on coimmunoprecipitation experiments one should be cautious to predict quantitative ratios of protein associations and therefore, further experiments need to determine whether calpain activation alters the amount of calpain bound to HIF-1
and whether this type of protein association is under the control of regulatory signaling pathways. | DISCUSSION |
|---|
|
|
|---|
under normoxia and its stabilization in hypoxia constitutes a major regulatory component in understanding cellular responses during the transition from ambient to low oxygen tension. We provide new evidence that calpain participates in destruction of HIF-1
, supporting the notion for a role of calcium in affecting expression of hypoxia-inducible genes. Studies in pVHL-deficient RCC4 cells and pVHL-containing RCC4/VHL or HEK293 cells imply that calpain-evoked destruction of HIF-1
must be considered an alternative system besides the established proteasomal degradation pathway to affect protein amount of HIF-1
. Moreover, our data provide an explanation to understand the HIF-1
-lowering capabilities of NO under hypoxia by showing destruction of HIF-1
independent of oxygen requirements.
Several independent lines of research have established the ability of RNI to stabilize HIF-1
protein and to exert genomic effects attributed to HIF-1 signaling (for references see Brüne and Zhou, 2003
). Mechanistically, this is explained by direct inhibition of PHD activity (Metzen et al., 2003
) and/or by enhancing phosphatidylinositol 3 kinase (PI3K)-dependent transcription/translation of HIF-1
(Kasuno et al., 2004
). It can be assumed that both mechanisms may operate at different concentrations of RNI. One expects direct PHD inhibition at higher and activation of PI3K by lower doses of RNI although, as suggested for hypoxia, PI3K activation may not be ubiquitously operating (Alvarez-Tejado et al., 2002
; Arsham et al., 2002
). In contrast, seminal observations reported that NO attenuated hypoxia-evoked HIF-1
protein accumulation and blocked HIF-1-transactivating capabilities (Huang et al., 1999
). Supporting studies noticed attenuated binding of HIF-1
to the DNA under hypoxic or CoCl2 treatments in combination with NO (Liu et al., 1998
; Sogawa et al., 1998
; Brüne and Zhou, 2003
). Considering the importance of PHDs in hydroxylating HIF-1
set the ground to understand fundamentals of oxygen sensing (Epstein et al., 2001
; Ivan et al., 2001
; Jaakkola et al., 2001
). This provoked the hypothesis to explain RNI actions in reverting HIF-1
accumulation by reactivating PHD activity under hypoxia. Indeed, Hagen et al. (2003
) showed restored PHD activity by NO under hypoxic conditions. It is argued that NO blocks mitochondrial respiration, thereby leaving more oxygen available for PHDs to reactivate them. Alternatively, NO is supposed to directly activate PHD in vitro (Wang et al., 2002
). Irrespective of underlying molecular mechanism the abovementioned suggestions center on reactivating PHD activity by NO under hypoxia to promote subsequent proteasomal degradation of HIF-1
. Results in RCC4 cells suggest an alternative, hydroxylation/ubiquitination/proteasome-independent degradation pathway that is calpain-mediated. Observations are based on the use of calpain inhibitors and manipulations of intracellular calcium to stimulate and/or inhibit calpain. These observations raise the interesting possibility that destruction of HIF-1
by calpain may represent an alternative proteolytic system that participates in adjusting the amount of HIF-1
to its demands and opens the possibility that two types of regulation, i.e., proteasomal versus calpain degradation may not be mutually exclusive. Of course further experiments need to determine the temporally and spatially contribution of calpain-mediated destruction of HIF-1
relative to the proteasome system.
Modulation of intracellular calcium is known to affect the expression of hypoxia-inducible genes and more recently, two reports provided evidence that lowering intracellular calcium by BAPTA-AM activates HIF-1 by attenuating hydroxylation of HIF-1
(Berchner-Pfannschmidt et al., 2004
; Liu et al., 2004
). Although the proposed mechanism will not be applicable to pVHL-deficient RCC4 cells, it supports the concept that calcium is involved in degradation of HIF-1
. Lowering calcium may not only block PHD activity but also attenuate calpain and both actions may synergize in stabilizing HIF-1
. However, on the basis of current information one would not assume a simple role of calcium as several reports noticed the involvement of calcium and/or calmodulin in signal transduction pathways, e.g., ERK activation (Mottet et al., 2003
; Liu et al., 2004
), leading to enhanced HIF-1 transcriptional activity (Yuan et al., 2005
). The dual role of calcium is reflected by showing that chelating calcium provoked a transient HIF-1
increase by attenuating protein degradation, whereas the calcium ionophore A23187
[GenBank]
induced HIF-1
mRNA expression at the same time (Liu et al., 2004
). In other systems calcium failed to affect HIF-1
protein and/or HIF-1dependent transcription (Salnikow et al., 2002
). Therefore, the role of calcium in supporting or antagonizing hypoxic responses is not yet fully defined and variables such as the calcium concentrations, calcium compartments, and cell typespecific effects need to be sorted out.
As shown in RCC4 cells, the combination of hypoxia/DETA-NO, as well as an increase in calcium as a result of ionomycin or thapsigargin treatment, lowered accumulation of HIF-1
. The ability of BAPTA-AM to reverse these effects argues for a direct role of calcium. This suggests that hypoxia/DETA-NO raises calcium, which in turn activates calpain because HIF-1
digestion is suppressed by calpain inhibitors. Along that line a previous report indeed suggested a calcium increase and calpain activation by RNI (Sanvicens et al., 2004
). In addition, experiments in HEK293 and RCC4/VHL cells that contain a functional pVHL-dependent proteolytic machinery showed that the calpain pathway can be activated when PHD activity is blocked. These observations may be relevant to understand HIF-1
disappearance under periods of long lasting and/or severe hypoxia in close association with calcium fluctuations. Alternatively, destruction of HIF-1
by NO via the calpain system might help to understand how NO mediates chemosensitivity in tumor cells, considering that hypoxia, i.e., expression of HIF-1
in tumors is associated with increased resistance to radiotherapy (Mitchell et al., 1998
; Matthews et al., 2001
). In addition, the biological relevance of this process can be envisioned when inducible NO-synthase is expressed as a HIF-1 target gene (Jung et al., 2000
) and the production of NO may initiate a feedback regulatory loop to limit continuation of hypoxic responses.
Our studies suggest that activation of calpain participates in regulating the stability of HIF-1
, a pathway with importance to understand pVHL-independent degradation of the protein. Degradation of HIF-1
by calpain may help to realize how hypoxia and NO work together in attenuating HIF-1
expression as well as HIF-1 signaling.
| ACKNOWLEDGMENTS |
|---|
|
|
|---|
| Footnotes |
|---|
Address correspondence to: Bernhard Brüne (bruene{at}zbc.kgu.de).
| REFERENCES |
|---|
|
|
|---|
Alvarez-Tejado, M., Alfranca, A., Aragones, J., Vara, A., Landazuri, M. O., and del Peso, L. ((2002). ). Lack of evidence for the involvement of the phosphoinositide 3-kinase/Akt pathway in the activation of hypoxia-inducible factors by low oxygen tension. J. Biol. Chem. 277, , 1350813517.
Arsham, A. M., Plas, D. R., Thompson, C. B., and Simon, M. C. ((2002). ). Phosphatidylinositol 3-kinase/Akt signaling is neither required for hypoxic stabilization of HIF-1alpha nor sufficient for HIF-1-dependent target gene transcription. J. Biol. Chem. 277, , 1516215170.
Berchner-Pfannschmidt, U., Petrat, F., Doege, K., Trinidad, B., Freitag, P., Metzen, E., de Groot, H., and Fandrey, J. ((2004). ). Chelation of cellular calcium modulates hypoxia-inducible gene expression through activation of hypoxia-inducible factor-1alpha. J. Biol. Chem. 279, , 4497644986.
Bruick, R. K. ((2003). ). Oxygen sensing in the hypoxic response pathway: regulation of the hypoxia-inducible transcription factor. Genes Dev. 17, , 26142623.
Bruick, R. K., and McKnight, S. L. ((2001). ). A conserved family of prolyl-4-hydroxylases that modify HIF. Science 294, , 13371340.
Brüne, B., and Zhou, J. ((2003). ). The role of nitric oxide (NO) in stability regulation of hypoxia inducible factor-1alpha (HIF-1alpha). Curr. Med. Chem. 10, , 845855.[CrossRef][Medline]
Cockman, M. E., Masson, N., Mole, D. R., Jaakkola, P., Chang, G. W., Clifford, S. C., Maher, E. R., Pugh, C. W., Ratcliffe, P. J., and Maxwell, P. H. ((2000). ). Hypoxia inducible factor-alpha binding and ubiquitylation by the von Hippel-Lindau tumor suppressor protein. J. Biol. Chem. 275, , 2573325741.
Epstein, A. C. et al. ((2001). ). C. elegans EGL-9 and mammalian homologs define a family of dioxygenases that regulate HIF by prolyl hydroxylation. Cell 107, , 4354.[CrossRef][Medline]
Frank, R., and Overwin, H. ((1996). ). SPOT synthesis. Epitope analysis with arrays of synthetic peptides prepared on cellulose membranes. In: Methods in Molecular Biology, Vol. 66, , Totowa, NJ: Humana Press, 149169.[Medline]
Hagen, T., Taylor, C. T., Lam, F., and Moncada, S. ((2003). ). Redistribution of intracellular oxygen in hypoxia by nitric oxide: effect on HIF1alpha. Science 302, , 19751978.
Hart, T. W. ((1997). ). Some observation concerning the S-nitroso and S-phenyl-sulfonyl derivatives of L-cysteine and glutathione. Tetrahedron Lett. 26, , 20132016.
Hewitson, K. S. et al. ((2002). ). Hypoxia-inducible factor (HIF) asparagine hydroxylase is identical to factor inhibiting HIF (FIH) and is related to the cupin structural family. J. Biol. Chem. 277, , 2635126355.
Huang, L. E., and Bunn, H. F. ((2003). ). Hypoxia-inducible factor and its biomedical relevance. J. Biol. Chem. 278, , 1957519578.
Huang, L. E., Willmore, W. G., Gu, J., Goldberg, M. A., and Bunn, H. F. ((1999). ). Inhibition of hypoxia-inducible factor 1 activation by carbon monoxide and nitric oxide. J. Biol. Chem. 274, , 90389044.
Ivan, M., Kondo, K., Yang, H., Kim, W., Valiando, J., Ohh, M., Salic, A., Asara, J. M., Lane, W. S., and Kaelin, W. G., Jr. ((2001). ). HIFalpha targeted for VHL-mediated destruction by proline hydroxylation: implications for O2 sensing. Science 292, , 464468.
Jaakkola, P. et al. ((2001). ). Targeting of HIF-alpha to the von Hippel-Lindau ubiquitylation complex by O2-regulated prolyl hydroxylation. Science 292, , 468472.
Jung, F., Palmer, L. A., Zhou, N., and Johns, R. A. ((2000). ). Hypoxic regulation of inducible nitric oxide synthase via hypoxia inducible factor-1 in cardiac myocytes. Circ. Res. 86, , 319325.
Kaelin, W. G., Jr. ((2002). ). How oxygen makes its presence felt. Genes Dev. 16, , 14411445.
Kasuno, K., Takabuchi, S., Fukuda, K., Kizaka-Kondoh, S., Yodoi, J., Adachi, T., Semenza, G. L., and Hirota, K. ((2004). ). Nitric oxide induces hypoxia-inducible factor 1 activation that is dependent on MAPK and phosphatidylinositol 3-kinase signaling. J. Biol. Chem. 279, , 25502558.
Kimura, H., Weisz, A., Kurashima, Y., Hashimoto, K., Ogura, T., D'Acquisto, F., Addeo, R., Makuuchi, M., and Esumi, H. ((2000). ). Hypoxia response element of the human vascular endothelial growth factor gene mediates transcriptional regulation by nitric oxide: control of hypoxia-inducible factor-1 activity by nitric oxide. Blood 95, , 189197.
Lando, D., Peet, D. J., Whelan, D. A., Gorman, J. J., and Whitelaw, M. L. ((2002). ). Asparagine hydroxylation of the HIF transactivation domain: a hypoxic switch. Science 295, , 858861.
Lee, D. H., and Goldberg, A. L. ((1998). ). Proteasome inhibitors: valuable new tools for cell biologists. Trends Cell Biol. 8, , 397403.[CrossRef][Medline]
Liu, Q., Moller, U., Flugel, D., and Kietzmann, T. ((2004). ). Induction of plasminogen activator inhibitor I gene expression by intracellular calcium via hypoxia-inducible factor-1. Blood 104, , 39934001.
Liu, Y., Christou, H., Morita, T., Laughner, E., Semenza, G. L., and Kourembanas, S. ((1998). ). Carbon monoxide and nitric oxide suppress the hypoxic induction of vascular endothelial growth factor gene via the 5' enhancer. J. Biol. Chem. 273, , 1525715262.
Mahon, P. C., Hirota, K., and Semenza, G. L. ((2001). ). FIH-1, a novel protein that interacts with HIF-1alpha and VHL to mediate repression of HIF-1 transcriptional activity. Genes Dev. 15, , 26752686.
Masson, N., Willam, C., Maxwell, P. H., Pugh, C. W., and Ratcliffe, P. J. ((2001). ). Independent function of two destruction domains in hypoxia-inducible factor-alpha chains activated by prolyl hydroxylation. EMBO J. 20, , 51975206.[CrossRef][Medline]
Matthews, N. E., Adams, M. A., Maxwell, L. R., Gofton, T. E., and Graham, C. H. ((2001). ). Nitric oxide-mediated regulation of chemosensitivity in cancer cells. J. Natl. Cancer Inst. 93, , 18791885.
Metzen, E., Zhou, J., Jelkmann, W., Fandrey, J., and Brüne, B. ((2003). ). Nitric oxide impairs normoxic degradation of HIF-1alpha by inhibition of prolyl hydroxylases. Mol. Biol. Cell 14, , 34703481.
Mitchell, J. B., DeGraff, W., Kim, S., Cook, J. A., Gamson, J., Christodoulou, D., Feelisch, M., and Wink, D. A. ((1998). ). Redox generation of nitric oxide to radiosensitize hypoxic cells. Int. J. Radiat. Oncol. Biol. Phys. 42, , 795798.[CrossRef][Medline]
Mottet, D., Michel, G., Renard, P., Ninane, N., Raes, M., and Michiels, C. ((2003). ). Role of ERK and calcium in the hypoxia-induced activation of HIF-1. J. Cell. Physiol. 194, , 3044.[CrossRef][Medline]
Oehme, F., Ellinghaus, P., Kolkhof, P., Smith, T. J., Ramakrishnan, S., Hutter, J., Schramm, M., and Flamme, I. ((2002). ). Overexpression of PH-4, a novel putative proline 4-hydroxylase, modulates activity of hypoxia-inducible transcription factors. Biochem. Biophys. Res. Commun. 296, , 343349.[CrossRef][Medline]
Palmer, L. A., Gaston, B., and Johns, R. A. ((2000). ). Normoxic stabilization of hypoxia-inducible factor-1 expression and activity: redox-dependent effect of nitrogen oxides. Mol. Pharm. 58, , 11971203.[Medline]
Pugh, C. W., and Ratcliffe, P. J. ((2003). ). Regulation of angiogenesis by hypoxia: role of the HIF system. Nat. Med. 9, , 677684.[CrossRef][Medline]
Salnikow, K., Kluz, T., Costa, M., Piquemal, D., Demidenko, Z. N., Xie, K., and Blagosklonny, M. V. ((2002). ). The regulation of hypoxic genes by calcium involves c-Jun/AP-1, which cooperates with hypoxia-inducible factor 1 in response to hypoxia. Mol. Cell. Biol. 22, , 17341741.
Sandau, K. B., Zhou, J., Kietzmann, T., and Brüne, B. ((2001). ). Regulation of the hypoxia-inducible factor 1alpha by the inflammatory mediators nitric oxide and tumor necrosis factor-alpha in contrast to desferroxamine and phenylarsine oxide. J. Biol. Chem. 276, , 3980539811.
Sanvicens, N., Gomez-Vicente, V., Masip, I., Messeguer, A., and Cotter, T. G. ((2004). ). Oxidative stress-induced apoptosis in retinal photoreceptor cells is mediated by calpains and caspases and blocked by the oxygen radical scavenger CR-6. J. Biol. Chem. 279, , 3926839278.
Semenza, G. L. ((2003). ). Targeting HIF-1 for cancer therapy. Nat. Rev. Cancer 3, , 721732.[CrossRef][Medline]
Semenza, G. L., and Wang, G. L. ((1992). ). A nuclear factor induced by hypoxia via de novo protein synthesis binds to the human erythropoietin gene enhancer at a site required for transcriptional activation. Mol. Cell. Biol. 12, , 54475454.
Sogawa, K., Numayama-Tsuruta, K., Ema, M., Abe, M., Abe, H., and Fujii-Kuriyama, Y. ((1998). ). Inhibition of hypoxia-inducible factor 1 activity by nitric oxide donors in hypoxia. Proc. Natl. Acad. Sci. USA 95, , 73687373.
Tawa, N. E., Jr., Odessey, R., and Goldberg, A. L. ((1997). ). Inhibitors of the proteasome reduce the accelerated proteolysis in atrophying rat skeletal muscles. J. Clin. Invest. 100, , 197203.[Medline]
Thomas, D. D., Espey, M. G., Ridnour, L. A., Hofseth, L. J., Mancardi, D., Harris, C. C., and Wink, D. A. ((2004). ). Hypoxic inducible factor 1alpha, extracellular signal-regulated kinase, and p53 are regulated by distinct threshold concentrations of nitric oxide. Proc. Natl. Acad. Sci. USA 101, , 88948899.
Wang, F., Sekine, H., Kikuchi, Y., Takasaki, C., Miura, C., Heiwa, O., Shuin, T., Fujii-Kuriyama, Y., and Sogawa, K. ((2002). ). HIF-1alpha-prolyl hydroxylase: molecular target of nitric oxide in the hypoxic signal transduction pathway. Biochem. Biophys. Res. Commun. 295, , 657662.[CrossRef][Medline]
Wang, G. L., and Semenza, G. L. ((1995). ). Purification and characterization of hypoxia-inducible factor 1. J. Biol. Chem. 270, , 12301237.
Wellman, T. L., Jenkins, J., Penar, P. L., Tranmer, B., Zahr, R., and Lounsbury, K. M. ((2004). ). Nitric oxide and reactive oxygen species exert opposing effects on the stability of hypoxia inducible factor-1alpha (HIF-1alpha) in explants of human pial arteries. FASEB J. 18, , 379381.
Yuan, G., Nanduri, J., Bhasker, C. R., Semenza, G. L., and Prabhakar, N. R. ((2005). ). Ca2+/calmodulin kinase-dependent activation of hypoxia inducible factor 1 transcriptional activity in cells subjected to intermittent hypoxia. J. Biol. Chem. 280, , 43214328.
This article has been cited by other articles:
![]() |
B. Yu, Z.-H. Miao, Y. Jiang, M.-H. Li, N. Yang, T. Li, and J. Ding c-Jun Protects Hypoxia-Inducible Factor-1{alpha} from Degradation via Its Oxygen-Dependent Degradation Domain in a Nontranscriptional Manner Cancer Res., October 1, 2009; 69(19): 7704 - 7712. [Abstract] [Full Text] [PDF] |
||||
![]() |
B. Herr, J. Zhou, C. Werno, H. Menrad, D. Namgaladze, A. Weigert, N. Dehne, and B. Brune The supernatant of apoptotic cells causes transcriptional activation of hypoxia-inducible factor-1{alpha} in macrophages via sphingosine-1-phosphate and transforming growth factor-{beta} Blood, September 3, 2009; 114(10): 2140 - 2148. [Abstract] [Full Text] [PDF] |
||||
![]() |
C.-M. Lee, J. Pohl, and E. T. Morgan Dual Mechanisms of CYP3A Protein Regulation by Proinflammatory Cytokine Stimulation in Primary Hepatocyte Cultures Drug Metab. Dispos., April 1, 2009; 37(4): 865 - 872. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. Nanduri, N. Wang, G. Yuan, S. A. Khan, D. Souvannakitti, Y.-J. Peng, G. K. Kumar, J. A. Garcia, and N. R. Prabhakar Intermittent hypoxia degrades HIF-2{alpha} via calpains resulting in oxidative stress: Implications for recurrent apnea-induced morbidities PNAS, January 27, 2009; 106(4): 1199 - 1204. [Abstract] [Full Text] [PDF] |
||||
![]() |
F. A. Groenman, M. Rutter, J. Wang, I. Caniggia, D. Tibboel, and M. Post Effect of chemical stabilizers of hypoxia-inducible factors on early lung development Am J Physiol Lung Cell Mol Physiol, September 1, 2007; 293(3): L557 - L567. [Abstract] [Full Text] [PDF] |
||||
![]() |
B. Brune and J. Zhou Nitric oxide and superoxide: Interference with hypoxic signaling Cardiovasc Res, July 15, 2007; 75(2): 275 - 282. [Abstract] [Full Text] [PDF] |
||||
![]() |
U. Berchner-Pfannschmidt, H. Yamac, B. Trinidad, and J. Fandrey Nitric Oxide Modulates Oxygen Sensing by Hypoxia-inducible Factor 1-dependent Induction of Prolyl Hydroxylase 2 J. Biol. Chem., January 19, 2007; 282(3): 1788 - 1796. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||