![]() |
|
|
Vol. 17, Issue 6, 2581-2591, June 2006
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||





*Signalling and Motility Group, ||Cytoskeleton Dynamics Group, and
Department of Cell Biology, German Research Centre for Biotechnology, D-38124 Braunschweig, Germany;
Institute of Biophysical Chemistry, Hannover Medical School, D-30623 Hannover, Germany; and
Institute of Molecular Biotechnology, Austrian Academy of Sciences, A-1030 Vienna, Austria
Submitted November 30, 2005;
Revised March 6, 2006;
Accepted March 27, 2006
Monitoring Editor: Mark Ginsberg
| ABSTRACT |
|---|
|
|
|---|
| INTRODUCTION |
|---|
|
|
|---|
WASP and WAVE family proteins act downstream of Rho-family GTPases, the activation of which can trigger the formation of lamellipodia and filopodia (Hall, 1998
). In mammals, Rac subfamily GTPases (Rac1, -2, and -3) are thought to be essential for the protrusion of lamellipodia, whereas members of the Cdc42 family (Kozma et al., 1995
; Nobes and Hall, 1995
) and Rif (Rho in filopodia) trigger filopodia formation (Aspenstrom et al., 2004
; Pellegrin and Mellor, 2005
). Interestingly, WASP proteins can be activated by Rho-GTPases such as Cdc42 through direct proteinprotein interaction, whereas WAVEs are linked to Rac proteins by intermediary factors such as Specifically Rac-associated protein 1 (Sra-1) or its isogene PIR121, Nck-associated protein 1 (Nap1), Abl interactor (Abi) proteins, and a peptide called HSPC300. Sra/Nap/Abi/WAVE and HSPC300 constitute a stable protein assembly now generally referred to as the WAVE-complex (Stradal et al., 2004
). In various vertebrate and nonvertebrate systems, WAVE-complex assembly and stability was demonstrated recently to be essential for the induction and maintenance of lamellipodia protrusion, i.e., downstream of Rac activation (Kunda et al., 2003
; Rogers et al., 2003
; Steffen et al., 2004
). In this scenario, WAVE-complex recruitment to and activation at the cell periphery lead to activation of Arp2/3-complexmediated polymerization of actin filaments to drive lamellipodial protrusion. Arp2/3-complex, which is strongly enriched in lamellipodia is thought to induce de novo nucleation and/or branching of filaments generating the dense criss-cross arrangement of actin filaments observed by electron microscopy (Small et al., 1999
; Pollard and Borisy, 2003
). Filopodia, in contrast, are composed of bundles of parallel actin filaments (Small and Celis, 1978
; Small, 1988
), whose generation may or may not depend on the presence of lamellipodial actin meshworks (Faix and Rottner, 2006
).
Many early studies have documented the coexistence of lamellipodia and filopodia at the cell periphery and from recent studies on B16-F1 melanoma cells, Svitkina et al. (2003)
proposed a model for filopodia protrusion, coined "the convergent elongation model." In this model, filopodia arise from the lamellipodial meshwork by filament elongation from specific precursor sites, delta-shaped structures, which are generated by lateral translocation and conversion of a dendritic array of actin filaments. Thus, a "cascade pathway" of filopodia formation is foreseen (Biyasheva et al., 2004
), with lamellipodia polymerizing "upstream" in the signaling cascade to filopodia protrusion, implicating the dependence of filopodia formation on preexisting lamellipodia. Here, we have tested these models in mammalian cells by abolishing lamellipodia formation through knockdown of WAVE- or the Arp2/3-complex and in Dictyostelium amoebae by disruption of the genes encoding nap1 and scar.
| MATERIALS AND METHODS |
|---|
|
|
|---|
Dictyostelium discoideum Cells
Cultivation and transformation of D. discoideum AX2 wild-type (WT) strain was as described previously (Schirenbeck et al., 2005
). For construction of the scar (GenBank accession no. XM_633219) targeting vector, a 5' BamHI/PstI fragment and a 3' HindIII/SalI fragment were amplified from genomic AX2 WT DNA by PCR. The oligonucleotide primers used for the 5' fragment were 5'-CGCCGGATCCGCATGGTATTAATTACAAGATATTTACCA-3' and 5'-GCGCTGCAGGACCATCGTCCATGTATGGGTCCA-3' and the primers for the 3' fragment were 5'-GCGAAGCTTTCATTAAAACTCTACACCAATCCAGAC-3' and 5'-CGCGTCGACGTTTGCAGCTCCACCATTTTGTTGCAT-3'. Both fragments were gel purified after cleavage with BamHI/PstI and HindIII/SalI, and cloned into the corresponding sites of pLPBLP containing the blasticidin S resistance cassette (Faix et al., 2004
). The resulting vector was cleaved with BamHI and SalI and used to disrupt the scar gene in WT cells. The nap1 (GenBank accession no. XM_638991) targeting vector was generated using the same strategy. The oligonucleotide primers used for the 5' fragment were 5'-CGCGGGATCCGCATGGCACATACAAATTTACCAGAAA-3' and 5'-CGCCTGCAGTTCATTATGAATTGAAATTGACTGTAA-3' and the primers for the 3' fragment were 5'-CGCAAGCTTGATGGTGCCCTCAATCTCATCCTTAAACCT-3' and 5'-CGCGTCGACACATGGTTTATCTCTAAACAAATTCCA-3'. Null mutants were screened by PCR as described previously (Faix et al., 2004
). At least two independent clones were analyzed for each mutant. Scar and Nap1 null strains were transformed with green fluorescent protein (GFP)-dDia2 and fixed and stained as described previously (Schirenbeck et al., 2005
).
Antibodies and Immunoblotting
Polyclonal anti-Arp3 and monoclonal anti-Sra-1 antibodies were raised against synthetic peptides NH2-EELSGGRLKPKPIDV-COOH and NH2-CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS-COOH, respectively, and affinity purified using the same peptides immobilized on CNBr-Sepharose 4B (GE Healthcare, Little Chalfont, Buckinghamshire, United Kingdom). Specificity of Arp3 antibodies was confirmed as shown in Supplemental Figure S1. Anti-
-tubulin antibody was used as described previously (Steffen et al., 2004
). Monoclonal antibodies raised against p21-Arc (ArpC3; clone 24A6), p16A (ArpC5; clone 323H3) (Millard et al., 2003
), and Sra-1 (clone 30A4) are available from Synaptic Systems (Göttingen, Germany). The latter antibody was generated by immunization against peptide NH2-CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS-COOH. Polyclonal anti-WAVE2 and monoclonal anti-Abi-1 antibodies were kindly provided by Giorgio Scita (The FIRC Institute for Molecular Oncology, European Institute of Oncology, Milan, Italy) (Innocenti et al., 2004
; Steffen et al., 2004
). Anti-myc clone 9E10 was purchased from Abcam (Cambridge, United Kingdom). Polyclonal anti-GFP antibodies were as described previously (Faix et al., 2001
).
Immunoblotting was performed according to standard protocols. For the quantification of WAVE-complex subunits shown in Figure 1G, band intensities were measured by luminometry using a cooled charge-coupled device (CCD) camera (Luminescent image analyzer LAS-1000; Fujifilm, London, United Kingdom) and analyzed using AIDA software (Raytest, Straubenhardt, Germany). Data were expressed as percentage of control for each component as indicated.
Fluorescence and Time-Lapse Microscopy and Microinjection
B16-F1 and VA-13 cells were fixed with 4% formaldehyde (PFA) in phosphate-buffered saline (PBS) for 20 min, extracted with 0.1% Triton X-100 in 4% PFA for 50 s and stained with phalloidin and/or anti-myc as indicated. Alexa dye-labeled secondary reagents and phalloidin were from Invitrogen (Karlsruhe, Germany). L61Cdc42 was purified and injected at 1.5 mg ml1 essentially as described (Nobes and Hall, 1995
). Mammalian cells were observed on an inverted microscope (Axiovert 100TV; Carl Zeiss, Jena, Germany) equipped for epifluorescence as described previously (Steffen et al., 2004
). Dictyostelium cells were fixed, stained with tetramethylrhodamine B isothiocyanate-phalloidin and subjected to confocal scanning microscopy as described previously (Schirenbeck et al., 2005
). Live mammalian cells were observed in an open chamber with a heater controller (Warner Instruments, Hamden, CT) at 37°C. Data were acquired with a back-illuminated, cooled CCD camera (TE-CCD 800PB; Princeton Scientific Instruments, Princeton, CT) driven by IPLab software (Scanalytics, Fairfax, VA). For time-lapse microscopy with D. discoideum, cells were plated into glass-bottomed dishes (Corning Glassworks, Corning, NY) in phosphate buffer containing 14.7 mM KH2PO4 and 2.5 mM Na2HPO4, pH 6.0. Images were acquired via a CCD camera (XC-75CE; Sony, Cologne, Germany) coupled to an Argus 20 image processor (Hamamatsu, Herrsching, Germany) and digitalized using a video grabber (VG-5) and Scion Image 1.62 software (Scion, Frederick, MD). Data were stored as 16-bit digital images and processed using IPLab, Scion Image 1.62, and Adobe Photoshop 5.0/CS software (Adobe Systems, Mountain View, CA).
Quantification of Filopodia Formation Upon Cdc42 Injection
Rates of filopodia initiation were assessed from randomly chosen cell peripheries with 30 µm in width and over a time period of
20 min after injection of constitutively active Cdc42. Seven independent movies were analyzed for each experimental condition, i.e., control and Nap1 knockdown cells. Newly formed filopodia were marked manually at the time point of initiation as indicated in Supplemental Video 2, and counted subsequently. In total, 357 and 422 filopodia were marked and counted for control and Nap1 knockdown cells, respectively. Extension rates were measured by tracking the tips of individual filopodia protruding parallel to the substrate over time periods of not <66 s using the Dynamic Imaging Analysis System (Solltech, Oakdale, IA). In total, 84 (from 6 videos) and 81 (from 4 videos) filopodia were analyzed for control and Nap1 knockdown, respectively. Kymographs (Hinz et al., 1999
) were made with a custom-written script in IPLab software (Scanalytics).
Statistical analyses were carried out using SigmaPlot, version 9.0 (SPSS, Chicago, IL), Microsoft Excel, version 9.0 (Redmond, WA), and MINITAB, version 10.5 (Minitab, State College, PA).
Morphological Assessments of B16-F1 Cells
Transient RNA interference was performed and evaluated as described previously (Steffen et al., 2004
). Arp3 and p21-Arc knockdown cells were analyzed on day 5 and Nap1 knockdown cells on day 4 after transfection of the respective knockdown plasmid. For quantification of lamellipodia, cells were treated with aluminum fluoride (AlF4) for 20 min as described previously (Steffen et al., 2004
).
For filopodia quantification, cells were transfected with a mixture of pRK5-myc-L61Cdc42 and pRK5-myc-N17Rac in a ratio of 10:1 16 h before fixation and staining. EGFP-tagged versions of Scar-W or Scar-WA, which were generated by subcloning of respective fragments from pRK5-myc (Machesky and Insall, 1998
) to EGFP-C1 (BD Biosciences, San Jose, CA), were cotransfected along with L61Cdc42 and N17Rac in a ratio of 10:10:1. Statistics were done as described above.
Negative Staining and Electron Microscopy
Cells were plated on fibronectin-coated Formvar electron microscopy (EM) support films on coverslips and prepared for electron microscopy essentially as described previously (Small et al., 1999
). Briefly, cells were washed with PBS and extracted for 1 min with prewarmed extraction/fixation buffer (0.250.5% Triton X-100, 0.25% glutaraldehyde in cytoskeleton buffer [CB]; Small et al., 1999
). Cells were fixed with 1.0% glutaraldehyde in CB for at least 3 h at room temperature and incubated in the same buffer supplemented with 10 µg/ml phalloidin overnight at 4°C. After detaching the Formvar film from coverslips and mounting on 200 mesh Cu/Pd EM grids, the samples were rinsed with a few drops of SST/T (24% sodium silicotungstate, pH 78, 0.1250.25% trehalose) negative stain solution, and excess liquid was carefully removed. After air drying, the samples were analyzed using a LEO 910 transmission electron microscope at 80 kV and recorded on x-ray film.
| RESULTS |
|---|
|
|
|---|
|
Together, these data strongly suggest that filopodia formation induced by injection of L61Cdc42 requires neither functional WAVE-complex nor expression of prominent lamellipodia or membrane ruffles.
Arp2/3-Complex Knockdown Abrogates Lamellipodia Formation
Arp2/3-complex has frequently been implicated in triggering actin filament assembly in the formation of cellular projections, including filopodia (Svitkina et al., 2003
; Biyasheva et al., 2004
). To examine Arp2/3-complex function in the protrusion of both lamellipodia and filopodia, we suppressed constituents of this protein assembly by transient knockdown of ArpC3 (p21-Arc) and Arp3 in B16-F1 cells. To enable monitoring of Arp3 protein run-down after RNAi, we generated polyclonal anti-Arp3 antibodies (Supplemental Figure S1) for Western blot analyses. Both constituents of the Arp2/3-complex were virtually abolished on days 4 and 5 after transfection of respective knockdown plasmids (Figure 2A). As observed previously for Arp3 (Di Nardo et al., 2005
), knockdown of this subunit but not of the peripheral subunit p21-Arc resulted in reduced expression of other Arp2/3-complex constituents (Figure 2A), suggesting that Arp3 is required for complex stability in vivo. We then examined the morphology of mock and both Arp2/3-complex knockdown cell populations upon stimulation of lamellipodia formation by AlF4 (Figure 2, BD). Lamellipodia formation triggered by this treatment was shown to be strongly abrogated in cells interfered for WAVE-complex function (Steffen et al., 2004
). Importantly, lamellipodia formation was also severely impaired upon knockdown of both p21-Arc and Arp3 compared with control. Quantification of the percentage of cells with lamellipodia revealed that <5 and 10% of cells displayed detectable lamellipodia for p21-Arc and Arp3 knockdown cells, respectively (Figure 2E), confirming that Arp2/3-complex is indeed crucial for lamellipodia formation (Machesky and Insall, 1998
; Kunda et al., 2003
; Rogers et al., 2003
). These data unambiguously emphasize the relevance of Arp2/3-complexmediated actin filament assembly, most likely activated by WAVE-complex, for the formation of lamellipodia and membrane ruffles. In spite of the loss of prominent lamellipodia observed by phalloidin stainings of p21- and Arp3 knockdown cells, the cell peripheries of these cell populations still displayed actin filament bundles reminiscent of filopodia (Figure 2, C and D). To test for the subcellular distributions of distinct examples of both lamellipodial and filopodial markers upon interference with Arp2/3- or WAVE-complex, we stained mock and Nap1 or p21-Arc RNAi-treated B16-F1 cells with antibodies for cortactin, fascin, and the Arp2/3-complex subunit p16A as control. Because the actin filament and Arp2/3-complexinteracting protein cortactin was reported to be capable of Arp2/3-complex activation, at least in vitro (Uruno et al., 2001
; Weaver et al., 2003
), we tested whether its localization would suggest a potential contribution to Arp2/3-complex positioning or activation at the cell periphery in cells interfered for WAVE-complex function, although both Arp2/3-complex and cortactin were reported to be excluded from filopodia (Svitkina and Borisy, 1999
; Svitkina et al., 2003
). However, whereas cortactin accumulated in lamellipodia and membrane ruffles of mock RNAi cells, the cell peripheries of both Nap1 and p21-Arc knockdown cells were devoid of any specific cortactin enrichment (Supplemental Figure S2A). Accordingly, the Arp2/3-complex subunit p16A could not be detected at the peripheries of Nap1 or p21-Arc knockdown cells (Supplemental Figure S2B), suggesting that the bundled arrays observed in B16-F1 cells upon transient Nap1 knockdown were indeed formed independently of Arp2/3-complex activity. In contrast, fascin, a marker of protrusive filopodia and microspikes (Kureishy et al., 2002
; Svitkina et al., 2003
), was enriched in peripheral actin filament bundles of both mock and Nap1 or p21-Arc RNAi-treated cells (Supplemental Figure S2C), indicating that the bundled peripheral structures formed in transient Nap1 and p21-Arc knockdown B16-F1 cells indeed represented canonical filopodia capable of protruding independently of both WAVE- and Arp2/3-complexes.
|
|
Ultrastructure of Filopodia Formed in the Absence of Functional Arp2/3-Complex
To assess the ultrastructure of filopodia formed in our experiments, we prepared negatively stained whole mount cytoskeletons of mock-treated Nap1 (our unpublished data) or p21-Arc knockdown B16-F1 cells to examine the structure of the actin cytoskeleton in the presence and absence of functional Arp2/3-complex. In mock siRNA-treated cells (Figure 4, AC), filopodia seemed embedded into the criss-cross arrangement of lamellipodial actin filaments as described previously (Small, 1981
). As expected, lamellipodial actin filaments abutted the plasma membrane at slightly tilted angles (Figure 4C), which was in marked contrast to the organization of the cell periphery upon p21-Arc knockdown, characterized by concave bundles of filaments arranged in parallel to the cell periphery (Figure 4F). In these cells, filopodia mainly emanated from the edges of concave actin filament bundles (Figure 4D). Most notably, the ultrastructural organization of actin filaments in both base (Figure 4, B and E) and along shafts (Figure 4, G and H) of filopodia was indistinguishable between control and p21-Arc knockdown cells, suggesting that interference with Arp2/3-complex function does not affect the molecular mechanism of actin filament polymerization into filopodia.
|
|
| DISCUSSION |
|---|
|
|
|---|
Microinjection of constitutively active Rac1 into fibroblasts depleted by RNA interference of constituents of the WAVE-complex like Nap1 frequently caused membrane blebbing but no lamellipodium protrusion (Steffen et al., 2004
). As opposed to controls, Cdc42 injection failed to stimulate lamellipodium protrusion and membrane ruffling, indicating that Cdc42-induced formation of lamellipodia does indeed require Rac activation as suggested previously (Nobes and Hall, 1995
). Surprisingly, Cdc42 injection effected protrusion of multiple filopodia in Nap1 knockdown cells at a frequency and rate of elongation equivalent to controls, indicating that the efficiency of filopodia formation is independent of both WAVE-complex function and detectable lamellipodia, at least in fibroblasts.
We also demonstrate the dispensability of Arp2/3-complex for filopodia but not lamellipodia formation. Notably, lamellipodia protrusion was reported previously to be suppressed by knockdown of p20-Arc (Arp-C4) and p34-Arc (Arp-C2) subunits in Drosophila S2 cells (Kunda et al., 2003
; Rogers et al., 2003
). A recent provocative study failed to detect defects in filopodia formation in stable Arp3 knockdown fibroblasts (Di Nardo et al., 2005
). However, because these cells also showed unimpaired membrane ruffling and only partially blocked actin tail formation behind cytoplasmic Listeria monocytogenes, they apparently expressed residual levels of functional Arp2/3-complex. In our experiments, independent knockdowns of Arp3 and the peripheral p21-Arc subunit in B16-F1 mouse melanoma cells strongly abrogated lamellipodia protrusion, with p21-Arc being slightly more effective than Arp3 knockdown. Interestingly, in vitro reconstitution and examination of the actin nucleation activity of recombinant Arp2/3-complex demonstrated that Arp3 was indispensable for nucleation, whereas incomplete Arp2/3-assemblies lacking p21-Arc still showed some (but little) nucleation activity (Gournier et al., 2001
). The fact that lamellipodia formation upon p21-Arc knockdown was at least as strongly compromised as in Arp3 knockdown cells suggests that residual nucleation activity observed in the absence of p21-Arc in vitro is insufficient to trigger lamellipodia protrusion in vivo or alternatively that p21-Arc exerts additional functions essential for site-directed Arp2/3-complexmediated filament assembly in lamellipodia. Notwithstanding this, our data strongly suggest that Arp2/3-complex, most likely activated by WAVE-complex, is essential for the formation of lamellipodia and membrane ruffles, but not filopodia. This was confirmed by overexpression of Scar-WA, which interferes with site-directed Arp2/3-complexmediated actin filament nucleation in vivo, as exemplified by suppression of lamellipodia formation (Machesky and Insall, 1998
), the intracellular motility of Listeria (May et al., 1999
), and of actin assembly accompanying the internalization of clathrin-coated pits (Benesch et al., 2005
).
All these data suggest that the WAVE/Arp2/3-complex pathway is dispensable for filopodia protrusion, at least in mammals, which is contrasted by reduced filopodia numbers recently observed in Drosophila Scar knockdown cells (Biyasheva et al., 2004
). The reason for this discrepancy is currently unclear. Notably, filopodia-like structures observed by these authors were concluded to represent narrow lamellipodia rather than filopodia, formed by residual Scar activity, because they seemed to be composed of branched arrays of short actin filaments (Biyasheva et al., 2004
) instead of long, parallel arrays of filaments typical for filopodia. Our ultrastructural analyses of whole mount cytoskeletons of both control and Arp2/3-complex knockdown cells confirmed the presence of canonical filopodia in both cell types and loss of lamellipodial filament arrays in Arp2/3 knockdown cells.
Together, although our data do not exclude a route of filopodia formation involving the recruitment and bundling of preexisting lamellipodial actin filaments, they clearly demonstrate that filopodia can form in their absence.
A distinct advantage of RNA interference is that the function of a given protein may be addressed by transient depletion of its expression, allowing analysis even of proteins or protein complexes essential for cell viability and growth (Harborth et al., 2001
). Our experiments in mammalian cells unambiguously show that cells in which lamellipodia protrusion is abolished fail to display defects in the formation of filopodia, suggesting that the molecular regulation of lamellipodia and filopodia formation is distinct and separable, at least in mammalian cell types. However, it is difficult to formally exclude the presence of residual protein activity (for example, of WAVE-complex components), which may suffice for filopodia formation without the recognizable induction of lamellipodia. To address this issue directly, we turned to the evolutionary distant amoeba D. discoideum, which is a well proved model of cell motility (Affolter and Weijer, 2005
). The herein demonstrated filopodia formation in cells genetically disrupted for Scar and Nap1 cannot be explained by residual protein activity.
In addition to confirming the dispensability of WAVE-complex function in the formation of filopodia, our observations indicate that the molecular hardware of filopodium protrusion is conserved through evolution from amoebae to mammals. This conclusion is in line with the recent discovery of the pivotal function in filopodium formation of the Dictyostelium formin dDia2 (Schirenbeck et al., 2005
), as evidenced by its genetic disruption and accumulation at filopodia tips. Similar to dDia2, this localization was also observed for a mammalian diaphanous-related formin, mDia2, also known as Drf3 (Peng et al., 2003
; Pellegrin and Mellor, 2005
), although this protein is not detectable in certain fibroblast cell lines capable of filopodium formation. The latter observation may suggest a certain degree of redundancy in the molecular mechanism of filopodium protrusion in mammals, although the idea of a key function also for mammalian formin(s) in filopodial actin filament nucleation and/or elongation seems increasingly attractive.
In conclusion, a comparison of the common and distinct molecular mechanisms of actin reorganization in cellular model systems of evolutionary distant organisms continues to serve as a promising approach (Noegel and Schleicher, 2000
; Van Haastert and Devreotes, 2004
) to further our understanding of the regulation of actin-based motility in vivo.
| ACKNOWLEDGMENTS |
|---|
| Footnotes |
|---|
![]()
The online version of this article contains supplemental material at MBC Online (http://www.molbiolcell.org). ![]()
Address correspondence to: Theresia E.B. Stradal ( theresia.stradal{at}gbf.de) or Klemens Rottner ( klemens.rottner{at}gbf.de)
Abbreviations used: AlF4, aluminum fluoride; Nap1, Nck-associated protein 1; Sra-1, Specifically Rac-associated protein 1; WT, wild type.
| REFERENCES |
|---|
|
|
|---|
Aspenstrom, P., Fransson, A., Saras, J. (2004). Rho GTPases have diverse effects on the organization of the actin filament system. Biochem. J 377, 327337.[CrossRef][Medline]
Bear, J. E., Rawls, J. F., Saxe, C. L. 3rd. (1998). SCAR, a WASP-related protein, isolated as a suppressor of receptor defects in late Dictyostelium development. J. Cell Biol 142, 13251335.
Benesch, S., Polo, S., Lai, F. P., Anderson, K. I., Stradal, T. E., Wehland, J., Rottner, K. (2005). N-WASP deficiency impairs EGF internalization and actin assembly at clathrin-coated pits. J. Cell Sci 118, 31033115.
Biyasheva, A., Svitkina, T., Kunda, P., Baum, B., Borisy, G. (2004). Cascade pathway of filopodia formation downstream of SCAR. J. Cell Sci 117, 837848.
Di Nardo, A., Cicchetti, G., Falet, H., Hartwig, J. H., Stossel, T. P., Kwiatkowski, D. J. (2005). Arp2/3 complex-deficient mouse fibroblasts are viable and have normal leading-edge actin structure and function. Proc. Natl. Acad. Sci. USA 102, 1626316268.
Faix, J., Kreppel, L., Shaulsky, G., Schleicher, M., Kimmel, A. R. (2004). A rapid and efficient method to generate multiple gene disruptions in Dictyostelium discoideum using a single selectable marker and the Cre-loxP system. Nucleic Acids Res 32, e143.
Faix, J. and Rottner, K. (2006). The making of filopodia. Curr. Opin. Cell Biol 18, 1825.[CrossRef][Medline]
Faix, J., Weber, I., Mintert, U., Kohler, J., Lottspeich, F., Marriott, G. (2001). Recruitment of cortexillin into the cleavage furrow is controlled by Rac1 and IQGAP-related proteins. EMBO J 20, 37053715.[CrossRef][Medline]
Gournier, H., Goley, E. D., Niederstrasser, H., Trinh, T., Welch, M. D. (2001). Reconstitution of human Arp2/3 complex reveals critical roles of individual subunits in complex structure and activity. Mol. Cell 8, 10411052.[CrossRef][Medline]
Hall, A. (1998). Rho GTPases and the actin cytoskeleton. Science 279, 509514.
Harborth, J., Elbashir, S. M., Bechert, K., Tuschl, T., Weber, K. (2001). Identification of essential genes in cultured mammalian cells using small interfering RNAs. J. Cell Sci 114, 45574565.[Medline]
Hinz, B., Alt, W., Johnen, C., Herzog, V., Kaiser, H. W. (1999). Quantifying lamella dynamics of cultured cells by SACED, a new computer-assisted motion analysis. Exp. Cell Res 251, 234243.[CrossRef][Medline]
Innocenti, M., et al. (2005). Abi1 regulates the activity of N-WASP and WAVE in distinct actin-based processes. Nat. Cell Biol 7, 969976.[CrossRef][Medline]
Innocenti, M., Zucconi, A., Disanza, A., Frittoli, E., Areces, L. B., Steffen, A., Stradal, T. E., Di Fiore, P. P., Carlier, M. F., Scita, G. (2004). Abi1 is essential for the formation and activation of a WAVE2 signalling complex. Nat. Cell Biol 6, 319327.[CrossRef][Medline]
Kozma, R., Ahmed, S., Best, A., Lim, L. (1995). The Ras-related protein Cdc42Hs and bradykinin promote formation of peripheral actin microspikes and filopodia in Swiss 3T3 fibroblasts. Mol. Cell. Biol 15, 19421952.[Abstract]
Kunda, P., Craig, G., Dominguez, V., Baum, B. (2003). Abi, Sra1, and Kette control the stability and localization of SCAR/WAVE to regulate the formation of actin-based protrusions. Curr. Biol 13, 18671875.[CrossRef][Medline]
Kureishy, N., Sapountzi, V., Prag, S., Anilkumar, N., Adams, J. C. (2002). Fascins, and their roles in cell structure and function. Bioessays 24, 350361.[CrossRef][Medline]
Lommel, S., Benesch, S., Rottner, K., Franz, T., Wehland, J., Kuhn, R. (2001). Actin pedestal formation by enteropathogenic Escherichia coli and intracellular motility of Shigella flexneri are abolished in N-WASP-defective cells. EMBO Rep 2, 850857.[CrossRef][Medline]
Machesky, L. M. and Insall, R. H. (1998). Scar1 and the related Wiskott-Aldrich syndrome protein, WASP, regulate the actin cytoskeleton through the Arp2/3 complex. Curr. Biol 8, 13471356.[CrossRef][Medline]
Mallavarapu, A. and Mitchison, T. (1999). Regulated actin cytoskeleton assembly at filopodium tips controls their extension and retraction. J. Cell Biol 146, 10971106.
May, R. C., Hall, M. E., Higgs, H. N., Pollard, T. D., Chakraborty, T., Wehland, J., Machesky, L. M., Sechi, A. S. (1999). The Arp2/3 complex is essential for the actin-based motility of Listeria monocytogenes. Curr. Biol 9, 759762.[CrossRef][Medline]
Millard, T. H., Behrendt, B., Launay, S., Futterer, K., Machesky, L. M. (2003). Identification and characterisation of a novel human isoform of Arp2/3 complex subunit p16-ARC/ARPC5. Cell Motil. Cytoskeleton 54, 8190.[CrossRef][Medline]
Nobes, C. D. and Hall, A. (1995). Rho, rac, and cdc42 GTPases regulate the assembly of multimolecular focal complexes associated with actin stress fibers, lamellipodia, and filopodia. Cell 81, 5362.[CrossRef][Medline]
Noegel, A. A. and Schleicher, M. (2000). The actin cytoskeleton of Dictyostelium: a story told by mutants. J. Cell Sci 113, 759766.[Abstract]
Pellegrin, S. and Mellor, H. (2005). The Rho family GTPase Rif induces filopodia through mDia2. Curr. Biol 15, 129133.[CrossRef][Medline]
Peng, J., Wallar, B. J., Flanders, A., Swiatek, P. J., Alberts, A. S. (2003). Disruption of the Diaphanous-related formin Drf1 gene encoding mDia1 reveals a role for Drf3 as an effector for Cdc42. Curr. Biol 13, 534545.[CrossRef][Medline]
Pollard, T. D. and Borisy, G. G. (2003). Cellular motility driven by assembly and disassembly of actin filaments. Cell 112, 453465.[CrossRef][Medline]
Rogers, S. L., Wiedemann, U., Stuurman, N., Vale, R. D. (2003). Molecular requirements for actin-based lamella formation in Drosophila S2 cells. J. Cell Biol 162, 10791088.
Rottner, K., Behrendt, B., Small, J. V., Wehland, J. (1999). VASP dynamics during lamellipodia protrusion. Nat. Cell Biol 1, 321322.[CrossRef][Medline]
Schenck, A., Bardoni, B., Moro, A., Bagni, C., Mandel, J. L. (2001). A highly conserved protein family interacting with the fragile X mental retardation protein (FMRP) and displaying selective interactions with FMRP-related proteins FXR1P and FXR2P. Proc. Natl. Acad. Sci. USA 98, 88448849.
Schirenbeck, A., Bretschneider, T., Arasada, R., Schleicher, M., Faix, J. (2005). The Diaphanous-related formin dDia2 is required for the formation and maintenance of filopodia. Nat. Cell Biol 7, 619625.[CrossRef][Medline]
Scita, G., Nordstrom, J., Carbone, R., Tenca, P., Giardina, G., Gutkind, S., Bjarnegard, M., Betsholtz, C., Di Fiore, P. P. (1999). EPS8 and E3B1 transduce signals from Ras to Rac. Nature 401, 290293.[CrossRef][Medline]
Small, J. V. (1981). Organization of actin in the leading edge of cultured cells: influence of osmium tetroxide and dehydration on the ultrastructure of actin meshworks. J. Cell Biol 91, 695705.
Small, J. V. (1988). The actin cytoskeleton. Electron Microsc. Rev 1, 155174.[Medline]
Small, J. V. and Celis, J. E. (1978). Filament arrangements in negatively stained cultured cells: the organization of actin. Eur. J. Cell Biol 16, 308325.
Small, J. V., Celis, J. E., Isenberg, G. (1980). Aspects of cell architecture and locomotion. In: Transfer of Cell Constituents into Eukaryotic Cells, ed. J. E. Celis, A. Graessmann, A. Loyter. New York: Plenum Press, 75111.
Small, J., Rottner, K., Hahne, P., Anderson, K. I. (1999). Visualising the actin cytoskeleton. Microsc. Res. Tech 47, 317.[CrossRef][Medline]
Small, J. V., Stradal, T., Vignal, E., Rottner, K. (2002). The lamellipodium: where motility begins. Trends Cell Biol 12, 112120.[CrossRef][Medline]
Snapper, S. B., et al. (2001). N-WASP deficiency reveals distinct pathways for cell surface projections and microbial actin-based motility. Nat. Cell Biol 3, 897904.[CrossRef][Medline]
Steffen, A., Rottner, K., Ehinger, J., Innocenti, M., Scita, G., Wehland, J., Stradal, T. E. (2004). Sra-1 and Nap1 link Rac to actin assembly driving lamellipodia formation. EMBO J 23, 749759.[CrossRef][Medline]
Stradal, T. E., Rottner, K., Disanza, A., Confalonieri, S., Innocenti, M., Scita, G. (2004). Regulation of actin dynamics by WASP and WAVE family proteins. Trends Cell Biol 14, 303311.[CrossRef][Medline]
Svitkina, T. M. and Borisy, G. G. (1999). Arp2/3 complex and actin depolymerizing factor/cofilin in dendritic organization and treadmilling of actin filament array in lamellipodia. J. Cell Biol 145, 10091026.
Svitkina, T. M., Bulanova, E. A., Chaga, O. Y., Vignjevic, D. M., Kojima, S., Vasiliev, J. M., Borisy, G. G. (2003). Mechanism of filopodia initiation by reorganization of a dendritic network. J. Cell Biol 160, 409421.
Takenawa, T. and Miki, H. (2001). WASP and WAVE family proteins: key molecules for rapid rearrangement of cortical actin filaments and cell movement. J. Cell Sci 114, 18011809.[Abstract]
Uruno, T., Liu, J., Zhang, P., Fan, Y., Egile, C., Li, R., Mueller, S. C., Zhan, X. (2001). Activation of Arp2/3 complex-mediated actin polymerization by cortactin. Nat. Cell Biol 3, 259266.[CrossRef][Medline]
Van Haastert, P. J. and Devreotes, P. N. (2004). Chemotaxis: signalling the way forward. Nat. Rev. Mol. Cell. Biol 5, 626634.[CrossRef][Medline]
Weaver, A. M., Young, M. E., Lee, W. L., Cooper, J. A. (2003). Integration of signals to the Arp2/3 complex. Curr. Opin. Cell Biol 15, 2330.[CrossRef][Medline]
This article has been cited by other articles:
![]() |
J. R. Ryu, A. Echarri, R. Li, and A. M. Pendergast Regulation of Cell-Cell Adhesion by Abi/Diaphanous Complexes Mol. Cell. Biol., April 1, 2009; 29(7): 1735 - 1748. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Nakao, A. Platek, S. Hirano, and M. Takeichi Contact-dependent promotion of cell migration by the OL-protocadherin-Nap1 interaction J. Cell Biol., July 28, 2008; 182(2): 395 - 410. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. M. Wegner, C. A. Nebhan, L. Hu, D. Majumdar, K. M. Meier, A. M. Weaver, and D. J. Webb N-WASP and the Arp2/3 Complex Are Critical Regulators of Actin in the Development of Dendritic Spines and Synapses J. Biol. Chem., June 6, 2008; 283(23): 15912 - 15920. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. Noguchi, M. Lenartowska, A. D. Rogat, D. J. Frank, and K. G. Miller Proper Cellular Reorganization during Drosophila Spermatid Individualization Depends on Actin Structures Composed of Two Domains, Bundles and Meshwork, That Are Differentially Regulated and Have Different Functions Mol. Biol. Cell, June 1, 2008; 19(6): 2363 - 2372. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. Le Clainche and M.-F. Carlier Regulation of Actin Assembly Associated With Protrusion and Adhesion in Cell Migration Physiol Rev, April 1, 2008; 88(2): 489 - 513. [Abstract] [Full Text] [PDF] |
||||
![]() |
F. Korobova and T. Svitkina Arp2/3 Complex Is Important for Filopodia Formation, Growth Cone Motility, and Neuritogenesis in Neuronal Cells Mol. Biol. Cell, April 1, 2008; 19(4): 1561 - 1574. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Nemethova, S. Auinger, and J. V. Small Building the actin cytoskeleton: filopodia contribute to the construction of contractile bundles in the lamella J. Cell Biol., March 24, 2008; 180(6): 1233 - 1244. [Abstract] [Full Text] [PDF] |
||||
![]() |
T. Bosse, J. Ehinger, A. Czuchra, S. Benesch, A. Steffen, X. Wu, K. Schloen, H. H. Niemann, G. Scita, T. E. B. Stradal, et al. Cdc42 and Phosphoinositide 3-Kinase Drive Rac-Mediated Actin Polymerization Downstream of c-Met in Distinct and Common Pathways Mol. Cell. Biol., October 1, 2007; 27(19): 6615 - 6628. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. L. Gupton and F. B. Gertler Filopodia: The Fingers That Do the Walking Sci. Signal., August 21, 2007; 2007(400): re5 - re5. [Abstract] [Full Text] [PDF] |
||||
![]() |
Y. J. Sigal, O. A. Quintero, R. E. Cheney, and A. J. Morris Cdc42 and ARP2/3-independent regulation of filopodia by an integral membrane lipid-phosphatase-related protein J. Cell Sci., January 15, 2007; 120(2): 340 - 352. [Abstract] [Full Text] [PDF] |
||||
![]() |
B. P. Somesh, G. Vlahou, M. Iijima, R. H. Insall, P. Devreotes, and F. Rivero RacG Regulates Morphology, Phagocytosis, and Chemotaxis Eukaryot. Cell, October 1, 2006; 5(10): 1648 - 1663. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||