![]() |
|
|
Vol. 18, Issue 8, 3156-3168, August 2007
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Terry Fox Laboratory, British Columbia Cancer Research Centre, Vancouver, BC, Canada V5Z 1L3
Submitted October 19, 2006;
Revised May 24, 2007;
Accepted May 31, 2007
Monitoring Editor: Robert Parton
| ABSTRACT |
|---|
|
|
|---|
2, the C1 domain counteracts the SuPT domain and enables efficient RasGRP1 translocation to the plasma membrane. In fibroblasts, the PT domain is inactive as a plasma membrane targeter, and the C1 domain specifies constitutive targeting of RasGRP1 to internal membranes where it can be activated and trigger oncogenic transformation. Selective use of the C1, PT, and SuPT domains may contribute to the differential targeting of RasGRP1 to the plasma membrane versus internal membranes, which has been observed in lymphocytes and other cell types. | INTRODUCTION |
|---|
|
|
|---|
To be active as an exchange factor, RasGRP1 must be localized to cell membranes where Ras GTPases reside. This requirement provides an opportunity for positive or negative regulation. RasGRP1 contains a C1 domain that binds the lipid second messenger diacylglycerol (DAG), or DAG-mimetic phorbol esters (Ebinu et al., 1998
; Lorenzo et al., 2000
; Shao et al., 2001
; Rong et al., 2002
; Carrasco and Merida, 2004
; Madani et al., 2004
). Treatment of cells with DAG or phorbol esters results in the translocation of RasGRP1 to membranes (Ebinu et al., 1998
; Tognon et al., 1998
; Bivona et al., 2003
; Rambaratsingh et al., 2003
; Caloca et al., 2004
; Stone et al., 2004
), and it stimulates Ras activation via RasGRP1 (Ebinu et al., 1998
; Kawasaki et al., 1998
; Tognon et al., 1998
; Priatel et al., 2002
; Rambaratsingh et al., 2003
; Caloca et al., 2004
). In serum-stimulated NIH 3T3 fibroblasts (Tognon et al., 1998
) and COS cells (Caloca et al., 2003a
), RasGRP1 translocation to internal membranes (endoplasmic reticulum [ER] and Golgi) requires its C1 domain, and phorbol ester-induced transformation of fibroblasts by RasGRP1 is entirely dependent on the C1 domain (Tognon et al., 1998
). In combination, these observations support a model of RasGRP1 regulation involving C1 domain-mediated recruitment to membranes enriched in DAG and containing Ras GTPase substrates. This mechanism has the potential to positively regulate RasGRP1 in response to any receptor that couples to a DAG-generating phospholipase C (PLC). In addition to the C1 domain, RasGRP1 has a pair of EF-hands that have been implicated as calcium-responsive positive regulators (Ebinu et al., 1998
; Kawasaki et al., 1998
; Guilbault and Kay, 2004
), although no involvement of the EF-hands in regulating RasGRP1 localization has been established.
In the DT40 B cell line, B cell antigen receptor (BCR) ligation induces translocation of RasGRP1 to the plasma membrane (Caloca et al., 2004
). Membrane translocation of RasGRP1 is also induced by T cell antigen receptor (TCR) ligation in the Jurkat T cell line, although this is variably reported to be directed to the plasma membrane (Carrasco and Merida, 2004
; Zugaza et al., 2004
) or to Golgi membranes (Bivona et al., 2003
; Perez de Castro et al., 2004
). Membrane-selective localization of RasGRP1 may play a critical role in modifying the responses of T cells to TCR ligation. RasGRP1 is localized primarily to Golgi in thymocytes undergoing positive selection, but it is at the plasma membrane in thymocytes undergoing negative selection (Daniels et al., 2006
). In mature T cells, RasGRP1 translocates to the plasma membrane after engagement with antigen presenting cells, but it is predominantly at internal sites when the T cells are anergized before antigen presentation (Zha et al., 2006
). Differential spatial activation of DAG kinases, which convert DAG to phosphatidic acid, has been suggested as one physiological mechanism by which RasGRP1 could be switched between internal versus plasma membrane localization (Zha et al., 2006
). Alternatively, DAG generation at the plasma membrane via integrin-induced activation of phospholipase D and phosphatidic acid phosphatase can relocalize RasGRP1 from Golgi to plasma membranes in TCR-stimulated T cells (Mor et al., 2007
).
There is extensive evidence that a C1 domain-driven mechanism of translocation is essential for activation of RasGRP1 by antigen receptors. Deletion of the C1 domain eliminates TCR-induced activation of RasGRP1 (Roose et al., 2005
). BCR- or TCR-induced RasGRP1-dependent activation of Ras is dependent on PLC
(Ebinu et al., 2000
; Caloca et al., 2003b
; Perez de Castro et al., 2004
; Reynolds et al., 2004
; Zugaza et al., 2004
) and in the Jurkat T cell line is suppressed by DAG kinases (Sanjuan et al., 2003
). The requirement for PLC and DAG does not necessarily involve the translocation step of activation, because catalytic activation of RasGRP1 is dependent on phosphorylation by protein kinase Cs (PKCs) (Aiba et al., 2004
; Roose et al., 2005
; Zheng et al., 2005
), which are themselves dependent on DAG generated by receptor-coupled PLCs. However, PLC inhibition impairs TCR-induced accumulation of RasGRP1 in insoluble structures, which could represent membrane translocation (Ebinu et al., 2000
; Reynolds et al., 2004
), and overexpression of DAG kinase
reduces the plasma membrane translocation of RasGRP1, which is induced by TCR ligation in mature T cells (Zha et al., 2006
).
All of these experiments indicate that antigen receptor-induced activation of RasGRP1 includes a membrane translocation step that is driven by the C1 domain binding to DAG generated in membranes via receptor-coupled PLCs. However, when expressed in the Jurkat T cell line, the isolated C1 domain of RasGRP1 remained at internal membranes after TCR ligation, whereas the same stimulation induced translocation of either full-length RasGRP1 or a DAG-binding C1 domain from PKC
to the plasma membrane (Carrasco and Merida, 2004
). This unexpected result demonstrated that under some circumstances the C1 domain of RasGRP1 can fail to confer stable localization at the plasma membrane even when antigen receptor ligation results in generation of DAG predominantly at the plasma membrane. As pointed out by Carrasco and Merida (2004)
, this experiment also suggested that the full-length RasGRP1 protein can receive signals that override internal membrane targeting via the C1 domain. This motivated us to examine in detail the role of the C1 domain in BCR-induced activation of RasGRP1. We demonstrated that the C1 domain is essential for efficient BCR-induced translocation of RasGRP1 to the plasma membrane in DT40 cells. However, the C1 domain by itself is unable to direct RasGRP1 to the plasma membrane. Instead, it is the previously unrecognized Plasma membrane Targeter (PT) domain that specifies the plasma membrane as the site of translocation of RasGRP1. The C1 domain serves a secondary role as an enhancer of PT domain-dependent translocation of RasGRP1 to the plasma membrane, with cooperativity between these domains being required to confer stringent quantitative and spatial regulation of RasGRP1 by BCR.
| MATERIALS AND METHODS |
|---|
|
|
|---|
2-deficient DT40 cells were obtained from Mike Gold (University of British Columbia, Vancouver), and they were originally from T. Kurosaki (RIKEN Research Center, Yokohama, Japan). All DT40 cells used in this study were transfected with an expression plasmid expressing the ecotropic retroviral receptor, to make them permissible for infection with murine retroviral vectors. DT40 cells were cultured in RPMI 1640 medium (Stem Cell Technologies, Vancouver, BC, Canada) supplemented with 10% fetal bovine serum (Hyclone Laboratories, Logan, UT), 2% chicken serum (Invitrogen, Carlsbad, CA), and 50 µM 2-mercaptoethanol. NIH 3T3 cells from American Type Culture Collection (Manassas, VA) were cultured in DMEM (Stem Cell Technologies) containing 10% bovine calf serum (Hyclone). The origin and culture of WEHI-231 cells are as described previously (Guilbault and Kay, 2004
and anti-CD28 were from eBiosciences (San Diego, CA). Phorbol 12-myristate 13-acetate (PMA) was from Sigma-Aldrich (St. Louis, MO). Anti-extracellular signal-regulated kinase (ERK)1/2 anti-phospho-specific ERK1/2 antibodies were from Cell Signaling Technology (Danvers, MA), anti-green fluorescent protein (GFP) was from Abcam (Cambridge, MA), anti-hemagglutinin (HA) was from Covance (Princeton, NJ), and anti-pan Ras was from Calbiochem (San Diego, CA). Alexa fluor 488-conjugated anti-GFP polyclonal antibody was from Invitrogen. Horseradish peroxidase-conjugated secondary antibodies were from Jackson ImmunoResearch Laboratories.
Construction of Modified Forms of RasGRP1
The N-terminally GFP-tagged form of full-length murine RasGRP1 (RG1) was derived from the XFL construct described previously (Tognon et al., 1998
), with the GFP coding sequences from pEGFP-C1 (Clontech, Mountain View, CA) fused to amino acid 2 of RasGRP1 (GenBank accession no. NP_035376). The sequence at the fusion site is DELYKSGLRSSAQSEGTLGKAR, with the sequences that do not naturally occur in enhanced (e)GFP or RasGRP1 in italics. The following constructs are modifications of this RG1 construct with the indicated changes (sequences that do not naturally occur in RasGRP1 are italicized; C terminus indicated by star). RG1-GEFµ has a single R271E point mutation that disrupts binding to Ras GTPases (Park et al., 1994
; Tognon et al., 1998
). RG1
C1 = deletion of amino acids 538–595; sequence around deletion = YSKLGSTKSPAIS. RG1
PT = deletion of amino acids 717 to C terminus; sequence N-terminal to deletion = ASPCPSPAST*. RG1
C-term = deletion of amino acids 597 to C terminus; sequence around deletion = FECKKRIKPTEA*. RG1
C1+SuPT = deletion of amino acids 538–694; sequence around deletion = YSKLGSTPRKSAQ. RG1
SuPT = deletion of amino acids 646–694; sequence around deletion = VDHSEESTPRKSAQ. RG1/Pren = replacement of RasGRP1 amino acids 538 to C terminus with an HA epitope tag plus the prenylation signal of K-Ras; sequence from fusion to C terminus = YSKLGSTEAYPYDYASGSRKHKEKMSKDGKKKKKKSKTKCVIM*. The isolated C1 domain construct consisted of amino acids 540–596 of RasGRP1, fused at the N terminus to GFP (sequence around fusion = DELYKSGLRSLKSTFPHNF) and with the C-terminal sequence FECKKRIKPTEA*. The sequence around the GFP fusion is DELYKSGLRSLKSTFPHNF for the C1+C-term construct, and DELYKSGLRSLKST for the C-term, C-term
1, and C-term
2 constructs, with the N-terminal boundaries of the RasGRP1 sequences in the latter three constructs indicated in Figure 4C.
Construction of PKC C1 Domains
The C1b domain of murine PKC
encoding amino acids 229–280 (GenBank 45330876) was attached to an N-terminal GFP tag derived from EGFP-C1. The sequence around the fusion is RSLKSTMPHRFKV and the sequence at the C terminus is KVANLCKKRIKPT*. The tandem C1a+C1b domain segment of murine PKC
encoding amino acids 168–294 (GenBank accession no. 6755084) was attached to an N-terminal GFP tag derived from EGFP-C1. The sequence around the fusion is RSLKSTNGHKFMA and the sequence at the C terminus is VAPNCGVEA*.
Construction of GFP-tagged Ras Binding Domain and C1 Domain of Raf-1 (GFP-RBDL)
cDNA encoding amino acids 51-220 of human Raf-1, as described previously (Bondeva et al., 2002
), were amplified by polymerase chain reaction (PCR) and fused to the C terminus of GFP. The resulting encoded sequence at the N-terminal Raf boundary is STPSKTSNT and the Raf-1 C-terminal sequence is LTMRRMRESA* where italicized letters are not natural Raf-1 sequence.
Retroviral Transduction of Cell Lines
Transfection of BOSC23 ecotropic packaging cells with retroviral vector plasmid DNA was performed as described previously (Pear et al., 1993
). Virus-containing medium was supplemented with polybrene to 20 µg/ml and then added to an equal volume of DT40, WEHI-231 or DO11.10 cells (2 x 106/ml) in appropriate medium. After 5–10 h of culture, 2–3 volumes of medium was added. Transduced cells were selected by addition of puromycin 30–48 after infection. GFP-positive cells were then sorted by flow cytometry. Adherent NIH 3T3 cells were transduced in the same way, except with complete changes of medium.
Fluorescence Microscopy
Cells expressing different mutants of RasGRP1 were plated on poly-L-lysine–coated glass coverslips (using poly-D-lysine for WEHI-231 cells). Before stimulation, DT40, WEHI-231 and DO11.10 cells were cultured in serum-free medium for 3–4, 6, or 3 h, respectively. Cells were stimulated in Hank's buffer (Stem Cell Technologies) with 5 µg/ml anti-chicken immunoglobulin (Ig)M or 500 ng/ml PMA (Dt40 cells), 5 µg/ml anti-mouse IgM (WEHI-231 cells), or 10 µg/ml each of anti-CD3
+ anti-CD28 (DO11.10 cells). Cells were then fixed with 4% formaldehyde in PBS. In Figures 2B and C, 3A and B, 4A and B, 6, and 7B and F, DT40 cells were permeabilized with 0.2% Triton X-100 in phosphate-buffered saline (PBS) and stained with Alexa Fluor 488-conjugated anti-GFP antibody to increase sensitivity of detection of GFP. Fluorescence microscopy used a 450- to 485-nm excitation filter and a 500- to 545-emission filter. Images were captured using OpenLab imaging software. Images were used to score at least 100 cells for plasma membrane localization of the GFP fusion proteins. Only cells showing fluorescence well above autofluorescence levels were scored. The individual cells displayed in the figures were chosen to be representative of the majority of the population of cells, unless otherwise noted in the figure legends. Histograms of fluorescence intensities along segments were drawn by the profile function of Scion Image software.
To mark Golgi membranes, fixed cells were stained with mouse anti-GM130 followed by Alexa Fluor 647-conjugated anti-mouse IgG. ER was marked by treating unfixed cells with glibenclamide BODIPY-Texas Red (ER Tracker; Invitrogen), followed by fixation with formaldehyde in PBS as described above.
Stimulation and Lysis of Cells for Detection of P-ERK2 or Ras-GTP
DT40 cells (2.5 x 107) were incubated in activation buffer (25 mM HEPES, pH 7.2, 125 mM NaCl, 5 mM KCl, 1 mM CaCl2, 1 mM Na2HPO4, 0.5 mM MgSO4, 2 mM L-glutamine, 1 mM sodium pyruvate, 0.1% glucose, 0.1% bovine serum albumin [BSA], and 50 µM 2-mercaptoethanol) (Saxton et al., 1994
) for 10 min at 37°C before stimulation. Anti-chicken IgM was then added to a concentration of 5 µg/ml for the indicated times. Cells were immediately lysed with 2.5 volumes of ice-cold lysis buffer (25 mM HEPES, pH 7.5, 150 mM NaCl, 1% NP-40, 0.25% sodium deoxycholate, 10% glycerol, 25 mM NaF, 10 mM MgCl2, 1 mM EDTA, and 1 mM NaMoO4) containing 2 µg/ml aprotinin, 2 µg/ml leupeptin, 0.5 mM phenylmethylsulfonyl fluoride, and 1 mM activated Na3VO4.
Affinity Purification of Activated Ras GTPases by Raf-RBD Chromatography
Lysates prepared as described above were incubated for 30 min with glutathione S-transferase (GST)/Raf–RBD fusion protein, which had been prepared and prebound to glutathione-agarose beads as described previously (Taylor et al., 2001
). After washing, samples were eluted in Bio-Rad XT sample buffer (Bio-Rad, Hercules, CA), electrophoresed, and detected by Western blot as described below, using anti-HA or anti-pan Ras antibodies.
Western Blot Analysis
Samples containing equal quantities of total protein (measured by the BCA protein assay; Pierce Chemical, Rockford, IL) were denatured using Bio-Rad XT sample buffer, separated by gel electrophoresis on 12% XT-Criterion acrylamide gels (Bio-Rad), and transferred to polyvinylidene difluoride membranes (Millipore, Billerica, MA) by electroblotting. After blocking the membranes overnight at 4°C in Tris-buffered saline/Tween 20 (TBST) (25 mM Tris-HCl, pH 7.4, 3 mM KCl, 150 mM NaCl, and 0.05% Tween 20) containing 5% BSA, primary antibodies were applied to the membrane for 90 min at room temperature in 2% BSA TBST, and horseradish peroxidase-conjugated secondary antibodies were applied for 45 min at room temperature in TBST containing 1% BSA. Membranes were exposed to substrate/enhanced chemiluminescence (Santa Cruz Biotechnology, Santa Cruz, CA) and chemiluminescence was detected using the VersaDoc 5000 imaging system (Bio-Rad). P-ERK2 was quantified by band volume analysis using Quantity One software (Bio-Rad). In all Western blot figures, each panel is from a single blot, with gaps in the image indicating intervening segments of the blot that are not displayed. For Figure 7D, the activities of RasGRP1 mutants relative to RasGRP1 within the same experiment were calculated as follows, using RG1
C-term as an example: (P-ERK2 in cells expressing RG1
Cterm-P-ERK2 in cells expressing GFP control)/(P-ERK2 in cells expressing RG1 – P-ERK2 in cells expressing GFP control). These relative values from multiple experiments were then displayed as means ± SD. Two-tailed p values were calculated by one-sample t tests.
| RESULTS |
|---|
|
|
|---|
|
|
The C1 Domain Is a Major but Not Exclusive Contributor to BCR-induced Translocation of RasGRP1 to the Plasma Membrane, and It Is Incapable of Independently Mediating Plasma Membrane Targeting
Either deletion of the C1 domain (Figure 3A) or PLC
2 deficiency (Figure 3B) reduced translocation of RasGRP1 to the plasma membrane in response to BCR ligation. This confirmed that the C1 domain is needed for efficient translocation of RasGRP1 to the plasma membrane, via binding to DAG generated by PLC
2. However, in a substantial percentage of cells there was still detectable BCR-induced translocation of RasGRP1 to the plasma membrane in the absence of either the C1 domain or PLC
2 (examples shown in Figure 3, A and B). This was the first indication that RasGRP1 translocation to the plasma membrane can be achieved, albeit with reduced efficiency, through a mechanism that does not require the C1 domain.
|
To understand why the RasGRP1 C1 domain concentrated at internal membranes and failed to translocate to the plasma membrane in response to BCR ligation, we examined the distribution of DAG in DT40 cells by using a fusion of GFP to the tandem C1a + C1b domains of PKC
(Stahelin et al., 2005
). The pairing of DAG binding sites provided by the tandem C1 domains considerably increases the avidity of DAG binding (Codazzi et al., 2001
; Giorgione et al., 2003
). The tandem PKC
C1 domains localized intensely to internal membranes in unstimulated DT40 cells (Figure 3D), indicating that these membranes are enriched for DAG even in the absence of stimulation. BCR ligation induced translocation of the tandem PKC
C1 domains to the plasma membrane and the nuclear envelope, accompanied by partial retention at ER and Golgi (Figure 3D). Thus, the absence of translocation of the RasGRP1 C1 domain is not due to lack of BCR-induced DAG generation at the plasma membrane, but instead it could reflect insufficient avidity of the monomeric RasGRP1 C1 domain for DAG at the plasma membrane. To further examine this, we used the C1b domain of PKC
, which binds DAG with an affinity similar to that of RasGRP1 (Tognon et al., 1998
; Giorgione et al., 2006
) and which has a moderate preference for localizing to the plasma membrane versus internal membranes (Stahelin et al., 2005
). This C1 domain was similar to that of RasGRP1 in being partially localized to internal membranes in unstimulated cells, and increasing its localization to internal membranes in response to BCR ligation, but the C1b domain of PKC
additionally showed faint plasma membrane localization (Figure 3C). The RasGRP1 C1 domain seems to have two distinct deficiencies that make it incapable of mediating plasma membrane targeting in response to BCR; insufficient avidity for DAG when expressed in isolation (as seen also for the C1b domain of PKC
), and a preference for binding to internal membranes rather than the plasma membrane (in contrast to the C1b domain of PKC
). The latter could reflect higher affinity of the RasGRP1 C1 domain for saturated DAGs, which can be more abundant in internal versus plasma membranes (Carrasco and Merida, 2004
).
These experiments contradict the expectation that binding of the C1 domain to DAG generated at the plasma membrane by BCR-coupled PLC
2 should provide an effective and sufficient mechanism for translocating RasGRP1 exclusively to the plasma membrane. Nonetheless, either deletion of the C1 domain or PLC
2 deficiency partially impedes translocation of RasGRP1 to the plasma membrane. The C1 domain must cooperate with other domains of RasGRP1 to drive BCR-induced RasGRP1 translocation, and one or more of these other domains must be responsible for the preferential targeting of RasGRP1 to the plasma membrane rather than internal membranes.
The PT Domain of RasGRP1 Mediates BCR- and TCR-induced Plasma Membrane Targeting
The EF-hands of RasGRP1 (Figure 1) were the initial lead candidates for providing cooperativity with the C1 domain in maximizing BCR-induced plasma membrane localization, because they were the only other recognized regulatory domains within RasGRP1, and their deletion compromises RasGRP1-mediated apoptosis induction by BCR (Guilbault and Kay, 2004
). However, a C-terminally deleted form of RasGRP1 that retains both the C1 domain and the EF-hands (RG1
C-term) failed to translocate to the plasma membrane in response to BCR ligation (Figure 4A). In contrast, an N-terminally truncated form of RasGRP1 that lacks the EF-hands and retains only the C1 domain and the C-terminal region efficiently translocated to the plasma membrane in response to BCR ligation (C1+ C-term in Figure 4B). When expressed without the C1 domain, the C-terminal region translocated to the plasma membrane in response to BCR ligation, but with reduced efficiency in terms of the percentage of cells showing translocation and the quantity of plasma membrane translocation in those cells (Figure 4B). Thus, the C-terminal region is what cooperates with the C1 domain to achieve efficient plasma membrane targeting of RasGRP1. Progressive truncation of the C-terminal region localized its plasma membrane targeting activity to the 101 amino acids at the C terminus (C-term
2 in Figure 4, B and C). We refer to this as the PT domain. Deletion of the PT domain from RasGRP1 eliminated all detectable plasma membrane translocation in response to BCR ligation (Figure 4D). Thus, the PT domain is the component of RasGRP1 that confers plasma membrane targeting, and it is able to achieve this even in the absence of the C1 domain.
|
2) was strongly localized to the plasma membrane in both unstimulated and stimulated WEHI-231 cells (Figure 5A). In this B cell line, it seems that the PT domain is fully sufficient for plasma membrane localization, whereas the C1 domain specifies internal membrane localization.
|
+ anti-CD28 (Figure 5B). The percentage of DO11.10 cells showing detectable TCR-induced plasma membrane translocation was greatly reduced by deletion of the PT domain. When expressed in isolation, the PT domain was weakly localized to the plasma membrane in most DO11.10 cells, and TCR/CD28 ligation induced an increase in both the percentage of cells showing plasma membrane localization and the intensity of plasma membrane localization (Figure 5B). Therefore, the PT domain confers plasma membrane targeting of RasGRP1 in this T cell line, although with reduced efficiency in comparison to the DT40 and WEHI 231 B cell lines.
A Suppressor Domain Attenuates Constitutive Plasma Membrane Translocation via the PT Domain
The PT domain differed from full-length RasGRP1 by being partially plasma membrane localized in the absence of antigen receptor ligation (RG1 in Figure 4A vs. C-term
2 in Figure 4B), implying that full-length RasGRP1 contains one or more domains that negatively regulate plasma membrane targeting by the PT domain. This suppressor of PT (SuPT) function was conferred by a 51-amino acid segment lying between the C1 and PT domains (Figure 4C). When this SuPT domain was attached to the PT domain, it reduced both constitutive and BCR-induced plasma membrane localization (comparing C-term
1 to C-term
2 in Figure 4B). Deletion of the SuPT domain from RasGRP1 resulted in enhanced translocation to the plasma membrane in response to BCR ligation, which was particularly evident when BCR ligation induced only partial translocation of wild-type RasGRP1 (Figure 4E, bottom). The SuPT domain is thus effective at quenching the propensity of the adjacent PT domain to drive constitutive localization of RasGRP1 to the plasma membrane, but it does so at the cost of impeding the efficiency of BCR-induced translocation via the PT domain. As a result, the SuPT + PT complex provides only a partial solution to the problem of attaining stringent translocational regulation of RasGRP1 by BCR.
The C1 Domain Counteracts the SuPT Domain and Makes Translocation via the PT Domain Responsive to Regulation by PLC
2
Attachment of the C1 domain to the C-terminal region served to override the effect of the SuPT domain, resulting in high efficiency of BCR-induced plasma membrane translocation while still minimizing plasma membrane localization in the absence of BCR ligation (comparing C1+C-term to C-term in Figure 4B). Although BCR-induced plasma membrane translocation of the PT domain with or without the SuPT domain occurred independently of PLC
2 (comparing C-term and C-term
2 in Figure 4B vs. Figure 6), the ability of the C1 domain to enhance plasma membrane translocation was dependent on PLC
2 (comparing C1+C-term in Figures 4B vs. Figure 6). These results indicate that the C1 domain acts as a DAG-dependent positive mediator of translocation that counterbalances the ability of the SuPT domain to impede plasma membrane targeting by the PT domain. This concept was further tested by examining how the C1 domain and the SuPT domain functionally interact within full-length RasGRP1. As shown in Figure 3A, deletion of the C1 domain greatly reduced BCR-induced plasma membrane translocation, and it also eliminated activation of RasGRP1 in response to BCR ligation (Figure 7A). However, when the SuPT domain is deleted along with the C1 domain, BCR-induced plasma membrane localization and activation are both partially restored (Figure 7, B–D). Therefore, PT domain-mediated RasGRP1 activation at the plasma membrane can be achieved either by positive cooperativity with the C1 domain, or by inactivation of the SuPT domain.
|
|
C-term), there was no detectable localization at the plasma membrane after BCR ligation (Figure 4A). Nonetheless, RG1
C-term was activated by BCR ligation (Figure 7, D and E), demonstrating that plasma membrane localization is not required for BCR-induced RasGRP1 activation in DT40 cells. RG1
C-term was quite diffusely distributed in the DT40 cells both before and after BCR ligation (Figure 3A), but it was not as delocalized as GFP alone (Figure 2B) and it was partially in the cytoplasmic regions occupied by ER and Golgi (Figure 2A). This distribution resembles that of the isolated C1 domain of RasGRP1 (Figure 3C). In the absence of the PT domain, the C1 domain apparently provides interactions with internal membranes that are sufficient to enable productive encounters of RasGRP1 with its Ras substrates.
RG1
C-term requires BCR ligation to be activated (Figure 7E), even though its localization does not overtly change with BCR ligation (Figure 4A). When the C1 domain of RG1
C-term was replaced by a prenylation signal that provides constitutive membrane localization (Figure 7F), BCR ligation was still needed for activation (Figure 7G). This demonstrates that membrane localization, although critical for providing access to membrane-bound Ras GTPases, is insufficient for RasGRP1 activation. This is expected, given that RasGRP1 requires catalytic activation by PKCs, and PKCs are themselves activated by antigen receptor ligation (Roose et al., 2005
; Zheng et al., 2005
).
In NIH 3T3 Fibroblasts, the PT Domain Does Not Confer Plasma Membrane Localization or Contribute to Oncogenic Transformation by RasGRP1
RasGRP1 was initially identified as an oncogene by its ability to induce transformation of fibroblast cell lines (Ebinu et al., 1998
; Tognon et al., 1998
). This experimental system was subsequently used to define the roles of DAG and the C1 domain in driving membrane localization of RasGRP1, and in activating RasGRP1 as an oncogene (Tognon et al., 1998
). Having identified the PT domain as a critical mediator of RasGRP1 localization and activation in DT40 cells, we wanted to determine whether the PT domain influences RasGRP1 localization in fibroblasts and to examine the potential of this domain to provide a DAG-independent mechanism by which RasGRP1 can trigger oncogenesis.
RasGRP1 localizes to the ER and Golgi in serum-stimulated NIH 3T3 fibroblasts (Figure 8A) and its constitutive activation at these sites results in oncogenic transformation, evident by high cell refractility and loss of contact inhibition (Figure 8B). Deletion of the PT domain had no discernible effect on either the localization of RasGRP1 at internal membranes or its ability to induce transformation (Figure 8B). When expressed in isolation, the PT domain was distributed throughout NIH 3T3 fibroblasts, with no detectable plasma membrane localization (Figure 8C), indicating that lack of plasma membrane targeting is not imposed by the SuPT domain.
|
These results demonstrate that the PT domain is intrinsically nonfunctional as a plasma membrane targeter in NIH 3T3 fibroblasts, whereas the C1 domain serves to target RasGRP1 to internal membranes. The lack of plasma membrane targeting by the PT domain causes wild-type RasGRP1 in NIH 3T3 fibroblasts to behave equivalently to PT domain-deleted RasGRP1 in B cells.
| DISCUSSION |
|---|
|
|
|---|
2 is not high enough to draw the C1 domain away from internal membranes. The plasma membrane targeting function is instead provided by a previously unrecognized part of RasGRP1, the PT domain. A ligand for this domain is apparently localized at or close to the plasma membrane, and it is able to attract the PT domain to this site, weakly in the absence of BCR signaling and strongly once BCR is ligated. The PT domain contains a putative
helical segment capable of forming a leucine zipper (Figure 3C) (Tognon et al., 1998
Although the PT domain is solely responsible for specifying the plasma membrane as the site of translocation of RasGRP1, correct quantitative and spatial regulation of RasGRP1 translocation in DT40 cells is only achieved by the combined action of the PT, C1 and SuPT domains. We propose the following model for BCR-induced translocation of RasGRP1 (Figure 9). In unstimulated DT40 cells, there is negligible translocation of RasGRP1 to the plasma membrane because DAG is absent, the quantity of functional PT ligand is low, and the SuPT domain attenuates interaction of the PT domain with its ligand. Some RasGRP1 is free in the cytoplasm, whereas the remainder is weakly bound to internal membranes via the C1 domain. This interaction could be mediated by DAG constitutively found in internal membranes (Figure 9), or by interaction of the C1 domain with negatively charged phospholipids (Hurley and Meyer, 2001
; Cho and Stahelin, 2005
). After BCR ligation, two events occur that promote translocation of RasGRP1. The first is an increase in the quantity of functional PT ligand at the plasma membrane, which enables weak binding by RasGRP1 via the PT domain. The second BCR-induced event is generation of DAG at the plasma membrane by PLC
2. RasGRP1, which has been transiently recruited to the plasma membrane via the PT domain, can thus acquire an additional interaction via the C1 domain. The combination of the PT–ligand and C1–DAG interactions confers enough stability to maintain RasGRP1 at the plasma membrane, where it can be further activated by protein kinase Cs and access its Ras GTPase substrates.
|
2. The latter is critical for ensuring that RasGRP1 activation is DAG dependent and thus can be negatively regulated by DAG kinases (Topham and Prescott, 2001
The finding that RasGRP1 uses more than its single C1 domain to take the critical translocation step in the activation process fits with the precedents set by other C1 domain-containing proteins (Brose et al., 2004
). In conventional PKCs, selective binding to cellular membranes is achieved by cooperativity between a pair of C1 domains interacting with DAG and negatively charged phospholipids, in conjunction with a calcium-dependent phospholipid-binding C2 domain (Cho, 2001
). C1 domains also have contributory rather than deterministic roles in membrane localization of
-chimerin and protein kinase D1 (Oancea et al., 2003
; Hall et al., 2005
). The dependence of C1 domains on cooperation with other regulatory domains may increase the stringency of regulation of these proteins, by ensuring that their quantity and locale of activation is not simply a linear function of the concentration of diacylglycerol in membranes.
The membranes to which RasGRP1 is translocated in response to receptor ligation vary among different lymphoid cell lines or sublines, in some cases being at the plasma membrane (Caloca et al., 2003b
; Carrasco and Merida, 2004
; Zugaza et al., 2004
) and in others at the Golgi and/or ER (Bivona et al., 2003
; Perez de Castro et al., 2004
). RasGRP1 is localized predominantly to Golgi in thymocytes undergoing TCR-induced positive selection but is at the plasma membrane in thymocytes undergoing negative selection driven by more intense TCR signaling (Daniels et al., 2006
). Similarly, RasGRP1 translocates to the plasma membrane after TCR engagement via antigen-presenting cells, but it remains at internal sites when the TCR signaling is modulated by anergization (Zha et al., 2006
). Although TCR ligation alone can induce RasGRP1 localization to Golgi, combined ligation of TCR plus the integrin lymphocyte function-associated antigen 1can induce relocalization of RasGRP1 to the plasma membrane (Mor et al., 2007
). Membrane-selective localization of RasGRP1 could be determined by differences in the spatial distribution of diacylglycerol generation or degradation, e.g., via variable localization of phospholipase Ds (Mor et al., 2007
) or diacylglycerol kinases (Topham, 2006
). Alternatively or additionally, selective use of the C1, PT, and SuPT domains could provide a mechanism for varying the site of activation of RasGRP1. Using RasGRP1 mutants, we have demonstrated that this occurs in DT40 cells. Under the same stimulatory conditions, RasGRP1 can be localized to and active at either the plasma membrane or internal membranes, with the site of localization being determined by the availability of DAG for C1 domain-mediated binding to either the plasma membrane or internal membranes, the capability of the PT domain to redirect RasGRP1 specifically to the plasma membrane, and the capability of the SuPT domain to suppress plasma membrane targeting. In WEHI-231 B cells, the PT domain is exceptionally effective as a plasma membrane targeter, whereas the C1 domain contributes only to internal membrane localization. Plasma membrane targeting by the PT domain is less effective in DO11.10 T cells, resulting in only partial translocation of RasGRP1 to the plasma membrane in response to TCR ligation. In NIH 3T3 fibroblasts, the PT domain is completely ineffective, and localization of RasGRP1 is determined by the C1 domain, which targets it to internal membranes. All nonlymphoid cells examined thus far have internal membrane localization of RasGRP1 (Tognon et al., 1998
; Bivona et al., 2003
; Caloca et al., 2003a
). This could be a result of nonfunctionality of the PT domain itself or lack of expression or availability of the hypothetical ligand for the PT domain.
The combined actions of the C1, PT, and SuPT domains can have a predominant role in controlling access of RasGRP1 to membranes, but additional modes of regulation of RasGRP1 have been demonstrated or can be anticipated. Phosphorylation of RasGRP1 by PKCs seems to be essential for RasGRP1 activation, although this may act strictly at the level of stimulating exchange activity, because mutation of the major PKC phosphorylation site does not affect BCR-induced membrane translocation of RasGRP3 to the plasma membrane in DT40 cells (Aiba et al., 2004
). Previous studies have indicated that the EF-hands of RasGRP1 are required for its activation in B cells but not in fibroblasts (Tognon et al., 1998
; Guilbault and Kay, 2004
). In DT40 cells, efficient plasma membrane translocation of RasGRP1 via the PT domain can occur in the absence of the EF-hands, although this does not rule out the EF-hands acting in a more subtle or separate way as calcium-responsive modulators of RasGRP1 membrane binding or activation. It is notable that the RasGRP1 mutant that lacked the C1 and SuPT domains but retained the PT domain had reduced plasma membrane targeting in comparison with the isolated PT domain. This implies that an additional plasma membrane targeting suppressor may be located in the portion of RasGRP1 N-terminal to the C1 domain.
RasGRP1 is normally under strict transcriptional regulation in lymphocytes (Norment et al., 2003
), and additionally it requires antigen receptor ligation for its activation (Dower et al., 2000
; Coughlin et al., 2005
). Deregulated transcription of wild-type RasGRP1 in immature T cells initiates oncogenic transformation even in the absence of functional antigen receptors (Klinger et al., 2005
). B cells malignancies are also induced by deregulated expression of nonmutated RasGRP1 (Mikkers et al., 2002
; Suzuki et al., 2002
). The stringent antigen receptor-induced regulation of RasGRP1 that is mediated by cooperativity of the C1, PT, and SuPT domains may be lost in these cells. Although NIH 3T3 cells are a dubious model for lymphocyte transformation, they may provide some relevant insight into how biochemical deregulation of RasGRP1 can occur. In NIH 3T3 cells, the C1 domain is sufficient to localize RasGRP1 to internal membranes and to activate it as an oncogene, with no requirement for regulatory input from the PT or SuPT domains. This highlights the potential hazard of ectopic expression of RasGRP1, if it occurs in a cell in which the C1 domain can constitutively target RasGRP1 to membranes populated by Ras GTPases. Alternatively, there is potential for RasGRP1 deregulation to occur in lymphocytes via constitutive presentation of the PT ligand in combination with inactivation of the SuPT domain. This would result in antigen receptor-independent activation of RasGRP1 accompanied by resistance of RasGRP1 to negative regulation by DAG kinases (Topham and Prescott, 2001
; Sanjuan et al., 2003
; Regier et al., 2005
). Identifying the mechanism of activation of RasGRP1 as a physiological oncogene will require analyses of the location and domain dependence of RasGRP1 in normal versus transformed lymphocytes.
| ACKNOWLEDGMENTS |
|---|
2-deficient DT40 cell line. This research was supported by grants to R.J.K. from the Canadian Institutes of Health Research (for all experiments on regulation of RasGRP1 in lymphoid cells) and the Cancer Research Society (for analyses of NIH 3T3 cell transformation by RasGRP1). | Footnotes |
|---|
Address correspondence to: Robert Kay (rkay{at}bccrc.ca).
Abbreviations used: BCR, B cell antigen receptor; DAG, diacylglycerol; GFP, green fluorescent protein; PLC, phospholipase C; TCR, T cell antigen receptor.
| REFERENCES |
|---|
|
|
|---|
Bivona, T. G., Perez De Castro, I., Ahearn, I. M., Grana, T. M., Chiu, V. K., Lockyer, P. J., Cullen, P. J., Pellicer, A., Cox, A. D., and Philips, M. R. (2003). Phospholipase Cgamma activates Ras on the Golgi apparatus by means of RasGRP1. Nature 424, 694–698.[CrossRef][Medline]
Bondeva, T., Balla, A., Varnai, P., and Balla, T. (2002). Structural determinants of Ras-Raf interaction analyzed in live cells. Mol. Biol. Cell 13, 2323–2333.
Brose, N., Betz, A., and Wegmeyer, H. (2004). Divergent and convergent signaling by the diacylglycerol second messenger pathway in mammals. Curr. Opin. Neurobiol 14, 328–340.[CrossRef][Medline]
Caloca, M. J., Zugaza, J. L., and Bustelo, X. R. (2003a). Exchange factors of the RasGRP family mediate Ras activation in the Golgi. J. Biol. Chem 278, 33465–33473.
Caloca, M. J., Zugaza, J. L., Matallanas, D., Crespo, P., and Bustelo, X. R. (2003b). Vav mediates Ras stimulation by direct activation of the GDP/GTP exchange factor Ras GRP1. EMBO J 22, 3326–3336.[CrossRef][Medline]
Caloca, M. J., Zugaza, J. L., Vicente-Manzanares, M., Sanchez-Madrid, F., and Bustelo, X. R. (2004). F-actin-dependent translocation of the Rap1 GDP/GTP exchange factor RasGRP2. J. Biol. Chem 279, 20435–20446.
Carrasco, S., and Merida, I. (2004). Diacylglycerol-dependent binding recruits PKCtheta and RasGRP1 C1 domains to specific subcellular localizations in living T lymphocytes. Mol. Biol. Cell 15, 2932–2942.
Cho, W. (2001). Membrane targeting by C1 and C2 domains. J. Biol. Chem 276, 32407–32410.
Cho, W., and Stahelin, R. V. (2005). Membrane-protein interactions in cell signaling and membrane trafficking. Annu. Rev. Biophys. Biomol. Struct 34, 119–151.[CrossRef][Medline]
Codazzi, F., Teruel, M. N., and Meyer, T. (2001). Control of astrocyte Ca(2+) oscillations and waves by oscillating translocation and activation of protein kinase C. Curr. Biol 11, 1089–1097.[CrossRef][Medline]
Coughlin, J. J., Stang, S. L., Dower, N. A., and Stone, J. C. (2005). RasGRP1 and RasGRP3 regulate B cell proliferation by facilitating B cell receptor-Ras signaling. J. Immunol 175, 7179–7184.
Daniels, M. A., Teixeiro, E., Gill, J., Hausmann, B., Roubaty, D., Holmberg, K., Werlen, G., Hollander, G. A., Gascoigne, N. R., and Palmer, E. (2006). Thymic selection threshold defined by compartmentalization of Ras/MAPK signalling. Nature 444, 724–729.[CrossRef][Medline]
Dower, N. A., Stang, S. L., Bottorff, D. A., Ebinu, J. O., Dickie, P., Ostergaard, H. L., and Stone, J. C. (2000). RasGRP is essential for mouse thymocyte differentiation and TCR signaling. Nat. Immunol 1, 317–321.[CrossRef][Medline]
Dupuy, A. J., Akagi, K., Largaespada, D. A., Copeland, N. G., and Jenkins, N. A. (2005). Mammalian mutagenesis using a highly mobile somatic Sleeping Beauty transposon system. Nature 436, 221–226.[CrossRef][Medline]
Ebinu, J. O., Bottorff, D. A., Chan, E. Y., Stang, S. L., Dunn, R. J., and Stone, J. C. (1998). RasGRP, a Ras guanyl nucleotide-releasing protein with calcium- and diacylglycerol-binding motifs. Science 280, 1082–1086.
Ebinu, J. O., Stang, S. L., Teixeira, C., Bottorff, D. A., Hooton, J., Blumberg, P. M., Barry, M., Bleakley, R. C., Ostergaard, H. L., and Stone, J. C. (2000). RasGRP links T-cell receptor signaling to Ras. Blood 95, 3199–3203.
Giorgione, J., Hysell, M., Harvey, D. F., and Newton, A. C. (2003). Contribution of the C1A and C1B domains to the membrane interaction of protein kinase C. Biochemistry 42, 11194–11202.[CrossRef][Medline]
Giorgione, J. R., Lin, J. H., McCammon, J. A., and Newton, A. C. (2006). Increased membrane affinity of the C1 domain of protein kinase Cdelta compensates for the lack of involvement of its C2 domain in membrane recruitment. J. Biol. Chem 281, 1660–1669.
Guilbault, B., and Kay, R. J. (2004). RasGRP1 sensitizes an immature B cell line to antigen receptor-induced apoptosis. J. Biol. Chem 279, 19523–19530.
Hall, C., Lim, L., and Leung, T. (2005). C1, see them all. Trends Biochem. Sci 30, 169–171.[CrossRef][Medline]
Hurley, J. H., and Meyer, T. (2001). Subcellular targeting by membrane lipids. Curr. Opin. Cell Biol 13, 146–152.[CrossRef][Medline]
Kawasaki, H. et al. (1998). A Rap guanine nucleotide exchange factor enriched highly in the basal ganglia. Proc. Natl. Acad. Sci. USA 95, 13278–13283.
Kim, R., Trubetskoy, A., Suzuki, T., Jenkins, N. A., Copeland, N. G., and Lenz, J. (2003). Genome-based identification of cancer genes by proviral tagging in mouse retrovirus-induced T-cell lymphomas. J. Virol 77, 2056–2062.
Klinger, M. B., Guilbault, B., Goulding, R. E., and Kay, R. J. (2005). Deregulated expression of RasGRP1 initiates thymic lymphomagenesis independently of T-cell receptors. Oncogene 24, 2695–2704.[CrossRef][Medline]
Layer, K. et al. (2003). Autoimmunity as the consequence of a spontaneous mutation in Rasgrp1. Immunity 19, 243–255.[CrossRef][Medline]
Li, J., Shen, H., Himmel, K. L., Dupuy, A. J., Largaespada, D. A., Nakamura, T., Shaughnessy, J. D., Jr., Jenkins, N. A., and Copeland, N. G. (1999). Leukaemia disease genes: large-scale cloning and pathway predictions. Nat. Genet 23, 348–353.[CrossRef][Medline]
Liu, Y., Zhu, M., Nishida, K., Hirano, T., and Zhang, W. (2007). An essential role for RasGRP1 in mast cell function and IgE-mediated allergic response. J. Exp. Med 204, 93–103.
Lorenzo, P. S., Beheshti, M., Pettit, G. R., Stone, J. C., and Blumberg, P. M. (2000). The guanine nucleotide exchange factor RasGRP is a high-affinity target for diacylglycerol and phorbol esters. Mol. Pharmacol 57, 840–846.
Madani, S., Hichami, A., Cherkaoui-Malki, M., and Khan, N. A. (2004). Diacylglycerols containing Omega 3 and Omega 6 fatty acids bind to RasGRP and modulate MAP kinase activation. J. Biol. Chem 279, 1176–1183.
Mikkers, H., Allen, J., Knipscheer, P., Romeijn, L., Hart, A., Vink, E., Berns, A., and Romeyn, L. (2002). High-throughput retroviral tagging to identify components of specific signaling pathways in cancer. Nat. Genet 32, 153–159.[CrossRef][Medline]
Mor, A., Campi, G., Du, G., Zheng, Y., Foster, D. A., Dustin, M. L., and Philips, M. R. (2007). The lymphocyte function-associated antigen-1 receptor costimulates plasma membrane Ras via phospholipase D2. Nat. Cell Biol 9, 713–719.[CrossRef][Medline]
Morgan, G., Smith, S., Pak, J., Marshak-Rothstein, A., Fissore, R., and Osborne, B. (1999). Characterization of a mutant T-cell hybridoma line with defects in the TCR-mediated apoptotic pathway. Cell Death Differ 6, 36–47.[CrossRef][Medline]
Norment, A. M., Bogatzki, L. Y., Klinger, M., Ojala, E. W., Bevan, M. J., and Kay, R. J. (2003). Transgenic expression of RasGRP1 induces the maturation of double-negative thymocytes and enhances the production of CD8 single-positive thymocytes. J. Immunol 170, 1141–1149.
Oancea, E., Bezzerides, V. J., Greka, A., and Clapham, D. E. (2003). Mechanism of persistent protein kinase D1 translocation and activation. Dev. Cell 4, 561–574.[CrossRef][Medline]
Oh-hora, M., Johmura, S., Hashimoto, A., Hikida, M., and Kurosaki, T. (2003). Requirement for Ras guanine nucleotide releasing protein 3 in coupling phospholipase C-gamma2 to Ras in B cell receptor signaling. J. Exp. Med 198, 1841–1851.
Oki-Idouchi, C. E., and Lorenzo, P. S. (2007). Transgenic overexpression of RasGRP1 in mouse epidermis results in spontaneous tumors of the skin. Cancer Res 67, 276–280.
Park, W., Mosteller, R. D., and Broek, D. (1994). Amino acid residues in the CDC25 guanine nucleotide exchange factor critical for interaction with Ras. Mol. Cell. Biol 14, 8117–8122.
Pear, W. S., Nolan, G. P., Scott, M. L., and Baltimore, D. (1993). Production of high-titer helper-free retroviruses by transient transfection. Proc. Natl. Acad. Sci. USA 90, 8392–8396.
Perez de Castro, I., Bivona, T. G., Philips, M. R., and Pellicer, A. (2004). Ras activation in Jurkat T cells following low-grade stimulation of the T-cell receptor is specific to N-Ras and occurs only on the Golgi apparatus. Mol. Cell. Biol 24, 3485–3496.
Priatel, J. J., Chen, X., Dhanji, S., Abraham, N., and Teh, H. S. (2006). RasGRP1 transmits prodifferentiation TCR signaling that is crucial for CD4 T cell development. J. Immunol 177, 1470–1480.
Priatel, J. J., Teh, S. J., Dower, N. A., Stone, J. C., and Teh, H. S. (2002). RasGRP1 transduces low-grade TCR signals which are critical for T cell development, homeostasis, and differentiation. Immunity 17, 617–627.[CrossRef][Medline]
Rambaratsingh, R. A., Stone, J. C., Blumberg, P. M., and Lorenzo, P. S. (2003). RasGRP1 represents a novel non-protein kinase C phorbol ester signaling pathway in mouse epidermal keratinocytes. J. Biol. Chem 278, 52792–52801.
Regier, D. S., Higbee, J., Lund, K. M., Sakane, F., Prescott, S. M., and Topham, M. K. (2005). Diacylglycerol kinase iota regulates Ras guanyl-releasing protein 3 and inhibits Rap1 signaling. Proc. Natl. Acad. Sci. USA 102, 7595–7600.
Reynolds, L. F., de Bettignies, C., Norton, T., Beeser, A., Chernoff, J., and Tybulewicz, V. L. (2004). Vav1 transduces T cell receptor signals to the activation of the Ras/ERK pathway via LAT, Sos, and RasGRP1. J. Biol. Chem 279, 18239–18246.
Rong, S. B. et al. (2002). Structural basis of RasGRP binding to high-affinity PKC ligands. J. Med. Chem 45, 853–860.[CrossRef][Medline]
Roose, J. P., Mollenauer, M., Gupta, V. A., Stone, J., and Weiss, A. (2005). A diacylglycerol-protein kinase C-RasGRP1 pathway directs Ras activation upon antigen receptor stimulation of T cells. Mol. Cell. Biol 25, 4426–4441.
Sanjuan, M. A., Pradet-Balade, B., Jones, D. R., Martinez, A. C., Stone, J. C., Garcia-Sanz, J. A., and Merida, I. (2003). T cell activation in vivo targets diacylglycerol kinase alpha to the membrane: a novel mechanism for Ras attenuation. J. Immunol 170, 2877–2883.
Saxton, T. M., van Oostveen, I., Bowtell, D., Aebersold, R., and Gold, M. R. (1994). B cell antigen receptor cross-linking induces phosphorylation of the p21ras oncoprotein activators SHC and mSOS1 as well as assembly of complexes containing SHC, GRB-2, mSOS1, and a 145-kDa tyrosine-phosphorylated protein. J. Immunol 153, 623–636.[Abstract]
Shao, L., Lewin, N. E., Lorenzo, P. S., Hu, Z., Enyedy, I. J., Garfield, S. H., Stone, J. C., Marner, F. J., Blumberg, P. M., and Wang, S. (2001). Iridals are a novel class of ligands for phorbol ester receptors with modest selectivity for the RasGRP receptor subfamily. J. Med. Chem 44, 3872–3880.[CrossRef][Medline]
Stahelin, R. V., Digman, M. A., Medkova, M., Ananthanarayanan, B., Melowic, H. R., Rafter, J. D., and Cho, W. (2005). Diacylglycerol-induced membrane targeting and activation of protein kinase Cepsilon: mechanistic differences between protein kinases Cdelta and Cepsilon. J. Biol. Chem 280, 19784–19793.
Stone, J. C., Stang, S. L., Zheng, Y., Dower, N. A., Brenner, S. E., Baryza, J. L., and Wender, P. A. (2004). Synthetic bryostatin analogues activate the RasGRP1 signaling pathway. J. Med. Chem 47, 6638–6644.[CrossRef][Medline]
Suzuki, T., Shen, H., Akagi, K., Morse, H. C., Malley, J. D., Naiman, D. Q., Jenkins, N. A., and Copeland, N. G. (2002). New genes involved in cancer identified by retroviral tagging. Nat. Genet 32, 166–174.[CrossRef][Medline]
Taylor, S. J., Resnick, R. J., and Shalloway, D. (2001). Nonradioactive determination of Ras-GTP levels using activated ras interaction assay. Methods Enzymol 333, 333–342.[CrossRef][Medline]
Tognon, C. E., Kirk, H. E., Passmore, L. A., Whitehead, I. P., Der, C. J., and Kay, R. J. (1998). Regulation of RasGRP via a phorbol ester-responsive C1 domain. Mol. Cell. Biol 18, 6995–7008.
Topham, M. K. (2006). Signaling roles of diacylglycerol kinases. J. Cell. Biochem 97, 474–484.[CrossRef][Medline]
Topham, M. K., and Prescott, S. M. (2001). Diacylglycerol kinase zeta regulates Ras activation by a novel mechanism. J. Cell Biol 152, 1135–1143.
Zha, Y., Marks, R., Ho, A. W., Peterson, A. C., Janardhan, S., Brown, I., Praveen, K., Stang, S., Stone, J. C., and Gajewski, T. F. (2006). T cell anergy is reversed by active Ras and is regulated by diacylglycerol kinase-alpha. Nat. Immunol 7, 1166–1173.[CrossRef][Medline]
Zheng, Y., Liu, H., Coughlin, J., Zheng, J., Li, L., and Stone, J. C. (2005). Phosphorylation of RasGRP3 on threonine 133 provides a mechanistic link between PKC and Ras signaling systems in B cells. Blood 105, 3648–3654.
Zugaza, J. L., Caloca, M. J., and Bustelo, X. R. (2004). Inverted signaling hierarchy between RAS and RAC in T-lymphocytes. Oncogene 23, 5823–5833.[CrossRef][Medline]
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||