![]() |
|
|
Vol. 19, Issue 5, 1942-1951, May 2008
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||





*Biotechnological Center, Dresden University of Technology, 01307 Dresden, Germany;
Faculté de Pharmacie de Lille, Laboratoire de Chimie, BP 83 59006 Lille Cedex, France;
Max Planck Institute of Molecular Cell Biology and Genetics, 01307 Dresden, Germany; and ||Institute of Molecular Pharmacology, 10 13125, Berlin, Germany
Submitted February 1, 2008;
Revised February 7, 2008;
Accepted February 12, 2008
Monitoring Editor: Sandra Schmid
| ABSTRACT |
|---|
|
|
|---|
30 proteins belonging to three networks regulating either AP-3 coat assembly or septin polymerization or Rab7-dependent lysosomal transport. RNA interference shows that, among these proteins, the ARF-1 exchange factor brefeldin A-inhibited exchange factor 1, the ARF-1 GTPase-activating protein 1, the Cdc42-interacting Cdc42 effector protein 4, an effector of septin-polymerizing GTPases, and the phosphatidylinositol-3 kinase IIIC3 are key components regulating the targeting of lysosomal membrane proteins to lysosomes in vivo. This analysis reveals that these proteins, together with AP-3, play an essential role in protein sorting at early endosomes, thereby regulating the integrity of these organelles. | INTRODUCTION |
|---|
|
|
|---|
Many studies in yeast, Drosophila, and mammalian cells have illustrated that the heterotetrameric AP-3 adaptor complex, which belongs to a family composed of AP-1, AP-2, and AP-4, functions in the targeting of selected transmembrane proteins to lysosomes and lysosome-related organelles (Owen et al., 2004
; Robinson, 2004
). Thus, AP-3 dysfunction in mammalian cells leads to a missorting of lysosomal proteins such as lysosomal-associated membrane protein (LAMP)-1, lysosomal integral membrane protein (LIMP)-II, or CD63 toward the plasma membrane (Le Borgne et al., 1998
; Dell'Angelica et al., 1999
; Feng et al., 1999
). The sorting function of AP-3, which localizes to the trans-Golgi network (TGN) and to early endosomes (Dell'Angelica et al., 1997
; Simpson et al., 1997
; Peden et al., 2004
), relies on interactions of its subunits with tyrosine- or dileucine-based sorting signals contained in cytoplasmic domains of lysosomal membrane proteins (Bonifacino and Traub, 2003
). These cargo proteins are believed to follow a direct intracellular pathway from the biosynthetic to the endosomal/lysosomal system (Harter and Mellman, 1992
). However, recent studies have raised the possibility that they could also follow an indirect route via the plasma membrane for subsequent delivery to lysosomes (Janvier and Bonifacino, 2005
).
Thus far, only a few molecules of the AP-3 sorting machinery have been identified, making it difficult to fully understand where AP-3 functions and how it contributes to maintaining organelle identity. The ADP ribosylation factor (ARF)-1) guanosine triphosphatase (GTPase) regulates AP-3 binding onto membranes (Ooi et al., 1998
; Drake et al., 2000
) as it does for other coat components, such as AP-1 or Golgi-localized,
-ear-containing, ARF-binding proteins that function in the sorting of mannose 6-phosphate receptors (MPRs), or other proteins shuttling between the biosynthetic and the endocytic pathway (D'Souza-Schorey and Chavrier, 2006
). Phosphatidylinositides (PIPs) are known to confer, at least in part, identities to membrane domains, by regulating the activities of ARF effectors and thus local ARF activation necessary for subsequent coat binding (De Matteis and Godi, 2004
; Di Paolo and De Camilli, 2006
). Thus, the ARF-1 GTPase-activating protein (AGAP)1, whose activity is modulated by specific phosphatidylinositols (PIs), plays a critical role in AP-3-dependent sorting (Nie et al., 2003
). PIPs also provide additional binding sites for APs. For example, phosphatidylinositol 4-phosphate (PI-4P) is required for AP-1 binding (Heldwein et al., 2004
; Baust et al., 2006
), whereas phosphatidylinositol 4,5-bisphosphate is required for AP-2–dependent sorting (Honing et al., 2005
). PIPs are synthesized by specific kinases (Di Paolo and De Camilli, 2006
). For example, the PI-4 kinase (PI-4K) II
has been implicated in AP-1 binding in vivo (Wang et al., 2003
). This kinase is also present on purified AP-3–coated membranes (Salazar et al., 2005), thereby suggesting that AP-3, like AP-1 (Wang et al., 2003
), could sort membrane proteins in PI-4P–rich membrane domains, i.e., the TGN.
We have shown previously that proteomic screens applied to in vitro systems fully recapitulating AP-1 coat assembly could be used to identify protein networks supporting its sorting function (Baust et al., 2006
). Following a similar strategy here, we first set out to reconstitute AP-3 recruitment onto synthetic membranes. We then identified the recruited proteins by mass spectrometry, and we investigated the potential implication of several key components in the AP-3–dependent pathway by using RNA interference.
| MATERIALS AND METHODS |
|---|
|
|
|---|
-subunit (100/3), AP-2
-subunit (100/2), and β-tubulin (Sigma-Aldrich); clathrin heavy chain, AP-3
-subunit, β-PIX, and early endosomal antigen 1 (EEA1) (BD Biosciences, Heidelberg, Germany), Myc (9E10; MPI-CBG Antibody Facility, Dresden, Germany); green fluorescent protein (GFP; Roche Applied Science, Mannheim, Germany); and LAMP-1 and LAMP-2 (Developmental Studies Hybridoma Bank, University of Iowa, Iowa City, IA). Secondary antibodies were peroxidase-conjugated goat anti-mouse immunoglobulin (Ig)G and goat anti-rabbit IgG (Jackson ImmunoResearch Laboratories, Suffolk, United Kingdom), Alexa Fluor 546-conjugated goat anti-mouse IgG, and Alexa Fluor 488 goat anti-mouse IgG (Invitrogen, Karlsruhe, Germany). The cDNA for human Cdc42 effector protein 4 (Borg4) (RZPD, Berlin, Germany) was cloned in a pCMV-Tag3B vector (Stratagene, La Jolla, CA).
Liposomes and Peptides
Liposomes were formed and sized to 400 nm from a mixture of PC:PE:PS:cholesterol:anchor (4:3:1:1:1 M ratio) in chloroform/methanol as described previously (Baust et al., 2006
). Phosphoinositides in chloroform/methanol were added as 1% molar ratio. In standard assays, 10 µl of liposomes were used corresponding to
10 nmol of lipid and 0.5 nmol of peptide per reaction. The peptides used in this study were chemically modified at their N termini as described previously (Baust et al., 2006
), and they had the following amino acid sequences: LAMP-1 wt (GGRKRSHAGYQTI), LAMP-1 Y10A (GGRKRSHAGAQTI), LIMP-II wt (GRGQGSTDEGTADERAPLIRT), LIMP-II L18/I19A (GRGQGSTDEGTADERAPAART), gpI wt (GGKRMRVKAYRVDKSPYNQSMYYAGLPVDDFEDSESTDTEE), and gpI Y10, 23A DAC (GGKRMRVKAARVDKSPYNQSMYAAGLPVDDF).
Coat Recruitment Assay
Assays were performed in a total volume of 200 µl of recruitment buffer (25 mM HEPES-KOH, pH 7.2, 125 mM potassium acetate, 2.5 mM magnesium acetate, and 1 mM dithiothreitol), containing brain cytosol (10 mg/ml), liposomes (0.5 nmol of peptide per reaction) and guanosine 5'-O-(3-thio)triphosphate (GTP
S) (0.1 mM), and binding reactions were performed as described previously (Baust et al., 2006
). ARF-depleted cytosol was generated by gel filtration on Sephadex G50 and tested by Western blotting by using anti-ARF-1 antibodies. For mass spectrometric analyses, LIMP-II/PI-3P–containing liposomes were incubated with mouse brain cytosol and GTP
S, purified by flotation on sucrose density gradients, and concentrated by centrifugation. Liposome-bound proteins were separated by SDS-polyacrylamide gel electrophoresis (PAGE).
Electron Microscopy
AP-3–coated liposomes recovered by centrifugation were fixed with 2.5% glutaraldehyde in 0.1 M sodium cacodylate buffer, pH 7.4, and then they were postfixed with 1% osmium tetroxide. Membranes were then embedded in Epon. Thin sections were contrasted with uranyl acetate and lead citrate.
Protein Identification by Mass Spectrometry
Sample preparation, in-gel digestion, peptide extraction, and peptide separation were performed as described previously (Czupalla et al., 2005
). Liquid chromatography/tandem mass spectrometry analysis was performed on a Micromass CapLC liquid chromatography system and a quadrupole orthogonal acceleration time-of-flight mass spectrometer Q-TOF Ultima (Micromass, Manchester, United Kingdom) equipped with a Z-spray nanoelectrospray source. Protein identification by fragment ion analysis was performed using MASCOT (Matrix Science, London, United Kingdom). Search criteria were as follows: database, SwissProt (version 271205, 204086 sequences); taxonomy, mouse; mass accuracy, 0.5 Da for fragment analysis; and modifications, carbamidomethylation and methionine oxidation, maximum one missed cleavage site.
Small Interfering RNA (siRNA) Treatment and Antibody Uptake Assay
siRNAs targeting human proteins were used, with the following sequences (5'
3'): PI-4K II
(GGAUCAUUCCUGUCUUCAAtt, GGUAGUAUACCUGGCCAGUtt, ACCUAUAUGAACUCUUCTT), phosphatidylinositol 3-kinase (PI-3K) IIIC3 (GGAACAACGGUUUCGCUCUtt, GCUGUUAUCCUCUCAUUACtt, GCAUUGUUGAAGGGUGAUAtt), Borg4 (GGAAUAGGUUUUCCUCUGUtt, CCCUUGAUUCAGACCAUGGtt), ARAP1 (GGAAGGUGUGGACAGAAACtt, GGUAGUGAAAAUGAAAUGCtt), AP-1µ (GCCAGAUCAGUAUUGACCCtt, GCUCCCAGGUACCAAAAAGtt), AP-1
(GGAAGUUAUGUUCGUGAUGtt, GGCCAAUGAUUUAUUGGAUtt), and AP-3µ (GGAAUUACAGUGACAGUUCtt, GGUAGUAAAAGGGAACAUUtt). These siRNAs and a nontargeting control (siNon2) were purchased from Ambion (Foster City, CA). siRNAs against human brefeldin A-inhibited exchange factor 1 (Big1) (5'-UGAAUCACCUCAACUUAGAuu-3') (Shen et al., 2006
) were purchased from Dharmacon Research (Chicago, IL), and siRNAs against β-PIX (CCUUCAUGCGCCUGGAUAA, GCAGACCAGUGAGAAGUUA) were purchased from Invitrogen. The siRNAs used for knockdowns in the antibody uptake experiments are shown in italics.
HeLa cells stably expressing a GFP-tagged MPR (Waguri et al., 2003
) were transferred to fresh medium, and then they were incubated with either 100 nM siRNAs and Oligofectamine transfection reagent (Invitrogen) or with 20 nM siRNAs and Interferin transfection reagent (Polyplus, Illkirch, France), as recommended. Similar knockdown efficiencies have been observed for the two transfection conditions, as evaluated by Western blot when antibodies were available, or by quantitative polymerase chain reaction (QPCR) performed using the Brilliant SYBR Green QPCR Master Mix and a Mx400 QPCR System (Stratagene). The primers used for PCR were as follows: glyceraldehyde-3-phosphate dehydrogenase (5'-TCACCACCATGGAGAAGGC-3', 5'-GCTAAGCAGTTGGTGGTGCA-3'), BIG1 (5'-ACCGTCTCCAGTAAGCCA-3', 5'-TCAGGCTCTGTGTCATCC-3'), PI-3K IIIC3 (5'-CAGTCAGTTCCTGTGGCTG-3', 5'-TATCCAGGTGCCTGTCTC-3' and 5'-CTACATCCATCGGCTTCC-3', 5'-GGACCTTCTGACCACGAT-3'), Borg4 (5'-CCAATCCTCAAGCAACTGG-3', 5'-CTTCCTGGACAGGAGACT-3' and 5'-GGCCAACAGAGGAAAACCT-3', 5'-CAGGACCCTTGATTCAGAC-3'), and ARAP1 (5'-ACTTGCCCTCACGGTATG-3', 5'-ATGGACAGGAAGGTGTGG-3' and 5'-AGACGTTGCGCAGAAGAGA-3', 5'-GCTGTGACACACAGATGGA-3').
For antibody uptake, the siRNA-treated cells were incubated with antibodies diluted in DMEM with 1% bovine serum albumin and 25 nM HEPES, pH 7.4. HeLa cells were incubated either for 4 h with antibodies against LAMP-1 (0.8 µg/ml) or LAMP-2 (0.7 µg/ml) to monitor the integrity of the AP-3 pathway, or for 4 h with anti-GFP antibodies (1 µg/ml) to assess the integrity of the AP-1/MPR pathway. Cells were further washed with phosphate-buffered saline (PBS), fixed with 3% paraformaldehyde for 15 min at room temperature, permeabilized with 0.1% Triton X-100 for 5 min at room temperature, blocked with 3% bovine serum albumin for 30 min at room temperature, and then incubated with Alexa Fluor-labeled secondary antibodies for 20 min at room temperature. Finally, they were washed with PBS and mounted on microscope slides by using Mowiol (Calbiochem, Nottingham, United Kingdom). Samples were analyzed by confocal fluorescence microscopy, using a confocal laser scanning microscope LSM510 Meta and C-Apochromat 63x/1.20W and 40x/1.20W objectives (Carl Zeiss MicroImaging, Göttingen, Germany). For the analyses of the localizations of AP-3
, AP-1
, and of anti-GFP (4-h uptake), we used a Leica SP5 inverse confocal microscope, with HCX plan apochromat lambda blue 63x/1.4–0.60 or HCX plan apochromat 40x/1.25–0.75 objectives (Leica Microsystems, Mannheim, Germany). Cell fluorescence intensities per area unit were measured and quantified using Adobe Photoshop 7 (Adobe Systems, Mountain View, CA) and ImageJ software (http://rsb.info.nih.gov/ij/). We observed similar knockdown efficiencies and similar effects on antibody uptakes for all indicated siRNAs that targeted PI-3K IIIC3, ARAP1, and AP-1
, and the results shown represent an average of the oligonucleotides used for one protein. For Borg4 and β-PIX, we used only one siRNA for the antibody uptake experiments because the others lead to only
40% reduction in mRNA levels (data not shown). Such assays gave similar results as fluorescence-activated cell sorting analyses to monitor the amount of lysosomal membrane proteins or MPR present at the cell surface in siRNA-treated cells (data not shown).
| RESULTS |
|---|
|
|
|---|
S to stabilize GTPases in an active conformation. The proteoliposomes were purified, and the bound proteins were analyzed by Western blotting and identified by mass spectrometry.
AP-3 Binding Requires a Mosaic of Membrane Components: Intact Signals in Cargo Tails, ARF-1 and PI-3P
Figure 1 shows that AP-3, like AP-1, AP-2, and COP-I coats, bound to protein-free liposomes, as shown previously (Donaldson et al., 1991
; Zhu et al., 1999
; Drake et al., 2000
; Haucke et al., 2000
). However, AP-3 binding became more efficient and specific when LAMP-1 or LIMP-II cytoplasmic domains were incorporated onto liposomes. In contrast, AP-1, AP-2, and COP-I binding remained unaffected. Furthermore, AP-3 was not recruited onto liposomes containing LAMP-1 or LIMP-II tails with mutations in their tyrosine- or dileucine-based sorting signals, or onto liposomes containing the cytoplasmic tail of the varicella zoster virus glycoprotein I (gpI) that permits an efficient and specific recruitment of AP-1A (Baust et al., 2006
).
|
|
S and limiting concentrations of cytosol (3 mg/ml). Figure 3A shows that AP-3 recruitment increased in the presence of PI-3P, whereas the other PIPs tested had no effect. Under optimal conditions, >25% of the cytosolic AP-3 was recruited onto liposomes containing LIMP-II and PI-3P. In contrast, the recruitments of AP-1, AP-2, and COP-I remained unaffected (Figure 3B). Interestingly, PI-3P also increased ARF-1 recruitment, even onto liposomes devoid of LIMP-II tail.
|
Proteomic Analysis of AP-3–coated Liposomes
The cytosolic proteins bound onto LIMP-II– and PI-3P–containing liposomes were identified by mass spectrometry after fractionation by SDS-PAGE (Supplemental Figure S2). Our first analyses revealed that these proteoliposomes contained AP-3 as expected, but they also contained a significant amount of AP-1 (up to 30% of total mass), although our biochemical analysis showed that such liposomes did not recruit AP-1 in a specific manner. This observation probably reflects the low abundance of cytosolic AP-3 compared with AP-1. Thus, Table 1 only presents the
30 proteins specifically recruited together with AP-3 onto LIMP-II- and PI-3P–containing liposomes and it excludes those previously found on AP-1A–coated liposomes (Baust et al., 2006
). Several groups of proteins were distinguished. The first group comprises coat components, i.e., the AP-3 subunits, ARF-1 effectors such as Big1 (Shen et al., 2006
), the AP-3–associated AGAP1 (Nie et al., 2003
), as well as ARAP1, an ARF-1 GTPase-activating protein that also contains a Rho GTPase-activating domain (Miura et al., 2002
). Second, we found a Cdc42-dependent septin nucleation machinery, consisting of the Cdc42 effector protein 4 (Borg4) (Joberty et al., 2001
) and seven members of the septin family (Kinoshita, 2006
). This analysis also identified the Rho GTPase-activating protein 1 (p50RhoGAP), a potential linker between Rho and Rab GTPases (Sirokmany et al., 2006
). The third group comprises Rab GTPases, i.e., Rab5C, Rab7, and Rab3C, as well as the Rab GTPase-activating protein TBC1 domain family member 10. The fourth group contains Rab5 interactors, such as the Rab5 effectors EEA1, Rabaptin-5, Rabex-5, the orthologue of the yeast Vps45 (Zerial and McBride, 2001
), and huntingtin (Pal et al., 2006
). The fifth group represents kinases and kinase effectors, such as the Cdc42-binding protein kinase
, protein kinase Cβ, and protein kinase C
-binding protein (PICK1). Finally, several other proteins were also identified such as subunits of the vacuolar ATP synthase; GRIP1-associated protein 1 (GRASP-1), an endosomal protein with Ras GTPase nucleotide exchange activity (Stinton et al., 2005
); the N-ethylmaleimide sensitive factor (NSF), or the syntaxin-binding protein 1.
|
|
A first protein network identified in our proteomic screen comprises AP-3 subunits and proteins potentially regulating its ARF-1–dependent binding. A 75% reduction in the expression the ARF-1 guanine nucleotide exchange factor (GEF) Big1, a 70% reduction in the expression of ARF-1 GTPase activation protein (GAP) ARAP1 (Figure 5A), or a 60% reduction of AP-3 expression (Figure 5B and Supplemental Figure S3) resulted in a similar LAMP-1 missorting compared with control cells (Figure 5C). Accordingly, the amount of AP-3 bound to intracellular membranes was significantly reduced (Figure 6). The same knockdowns only slightly reduced the uptake of anti-GFP antibodies (Figure 5D and Supplemental Figure S5), although AP-3 and Big1 knockdowns resulted in the scattering of GFP-MPR–containing structures coated with AP-1 (Supplemental Figure S6). Alternately, AP-1
knockdown resulted in a slightly higher accessibility of the GFP-MPR to the cell surface, whereas that of β-PIX, a Rho exchange factor previously found associated with AP-1 (Baust et al., 2006
), resulted in a slight decrease (Figure 5D), without affecting LAMP-1 trafficking (Figure 5C). Thus, the ARF-1 GEF Big1 and the ARF-1 GAP ARAP1 seem to be key regulators of the AP-3–dependent sorting of LAMP-1.
|
|
, previously found to not only regulate AP-1 binding (Wang et al., 2003
(70% reduction) (Figure 5 and Supplemental Figure S3) resulted in phenotypes that were more difficult to interpret. First, it resulted in higher accessibilities of both LAMP-1 and GFP-MPR to the cell surface (Figure 5 and Supplemental S4 and S5). Second, GFP-MPR exhibited a more scattered distribution, being detected in structures only partially coated with AP-1 (Supplemental Figure S6). These phenotypes were not detected in the AP-1
or β-PIX knockdowns (Figure 5 and Supplemental S5 and S6). Thus, the PI-3 kinase IIIC3 is a key regulator of the AP-3–dependent sorting of LAMP-1. However, it would seem that the PI-4 kinase II
has a more pleiotropic effect, regulating both LAMP-1 and MPR trafficking in vivo.
Another protein network identified in our proteomic screen is made of septin GTPases and Borg4, a Cdc42 effector protein that regulates their polymerization (Joberty et al., 2001
). A 70% reduction in Borg4 expression (Figure 5A) or a 60% reduction in AP-3 expression (Figure 5B and Supplemental Figure S3) resulted in a similar LAMP-1 missorting (Figure 5C). Borg4 knockdown induced a slight scattering of AP-3–coated structures (Figure 6), and it resulted in the formation of longer septin2-positive filaments, sometimes forming bundles with actin (data not shown), along which AP-3–positive structures could be detected (Figure 7A). Borg4 knockdown resulted in a slight increase in anti-GFP antibody uptake (Figure 5 and Supplemental Figure S5) and in a dispersion of intracellular, GFP-MPR–containing structures still partially coated with AP-1 (Supplemental Figures S5 and S6). When a myc-tagged Borg4 was overexpressed in HeLa cells, the number of AP-3–coated structures decreased drastically. Nevertheless, the few remaining AP-3–coated structures partly localized with myc-tagged Borg4 (Figure 7B). Thus, the Cdc42-effector protein Borg4, and probably septin assembly, is an important regulator of AP-3–dependent sorting of LAMP-1 to lysosomes.
|
| DISCUSSION |
|---|
|
|
|---|
A Mosaic of Membrane Components Stabilizes AP-3 on Synthetic Membranes
AP-3 binding requires several membrane components. First, the ARF-1 GTPase is a key regulator. If this was expected from previous studies (Drake et al., 2000
, and references therein), our data show that specific ARF-1 effectors, i.e., Big1 and ARAP1, regulate AP-3–dependent lysosomal targeting, most likely by modulating a local ARF-1 activation and subsequent AP-3 binding. Our analysis also identified AGAP1, another ARF-1 GAP shown to regulate AP-3 function in vivo (Nie et al., 2003
). Second, sorting signals present in specific cargo transmembrane proteins play a key role by increasing and providing specificity to AP-3 binding, an observation that fully supports our previous findings (Le Borgne et al., 1998
). Interestingly, the presence of cargoes also enhances ARF-1 recruitment on synthetic membranes, as we observed previously for other cargoes on ARF-1 and AP-1A recruitment (Baust et al., 2006
). This suggests that cargoes, probably by stabilizing APs on membranes, can trigger amplification loops to expand specialized membrane domains able to sort incoming cargo molecules. Finally, PI-3P is the most efficient phosphatidylinositide for stabilizing AP-3 on membranes. Accordingly, the PI-3 kinase IIIC3, the orthologue of the yeast Vps34p whose activity is spatially controlled by the Rab5 GTPase (Zerial and McBride, 2001
; Shin et al., 2005
), confers a selective LAMP-1 targeting. In contrast, the PI-4 kinase II
, a kinase regulating AP-1 binding onto TGN membranes (Wang et al., 2003
) and recovered on purified AP-3–coated structures (Salazar et al., 2005), is involved not only in MPR trafficking but also in LAMP-1 trafficking. This finding was surprising because our biochemical study did not detect any requirement of PI-4P for AP-3 binding. Clearly, further studies are needed to elucidate the mechanisms by which this kinase regulates protein trafficking and organelle homeostasis.
Collectively, our present and former in vitro studies (Baust et al., 2006
) indicate that the two related AP-3 and AP-1 adaptor complexes, both functioning in lysosomal targeting, follow similar principles of binding to synthetic membranes. It is the combinatorial use of membrane components that determines their stable interactions. Their selective interactions however require different but related components: specific PIPs and lipid kinases; specific ARF GEFs and GAPs whose compartmentalization could mediate a local ARF-1 activation; and finally, selected cargoes with intact sorting signals exhibiting preferred interactions for either AP-3 or AP-1.
Protein Networks Detected on LIMP-II– and PI-3P–containing Liposomes
The identified proteins belong to three major protein networks involved in either AP-3 binding or septin dynamics or early sorting endosome dynamics. In addition, we identified several kinases and interacting proteins that could regulate the recruitment of these components onto membranes. Interestingly, several of these proteins, including Rab5C, Rab7, and Rab3C, the early endosomal marker EEA1, the catalytic subunits of the vacuolar ATP synthase, and PICK1, were found associated with AP-3–coated organelles isolated from cells (Salazar et al., 2005). The recruitment of Rab5 and its effectors, such as EEA1, is only determined by the presence of PI-3P on synthetic membranes, in agreement with previous studies (Zerial and McBride, 2001
; Shin et al., 2005
). In contrast, the recruitments of AP-3, the septin GTPases, and Rab7 need the presence of cargoes (septin7), or both cargoes and PI-3P (AP-3, Rab7). It is difficult to understand how cargo tails, which bind to AP coats, could stabilize septins and Rab7 on membranes. The simplest explanation is that AP-3 binds first to membranes in a cargo-dependent manner, and then it stabilizes the other machineries by virtue of protein–protein interactions.
We showed earlier that well-defined synthetic membrane domains not only recruit AP-1A coats, including ARF-1 and its specific effectors, but also a machinery regulating actin nucleation (Rac-1, its effectors, and the Wave/Scar complex) and the Rab11 and Rab14 GTPases regulating membrane dynamics between the TGN and endosomes (Baust et al., 2006
). Collectively, our studies identifying >80 proteins, strongly suggesting that distinct, defined membrane domains stabilize either the AP-3 or the AP-1A coat, together with well-defined components: septin- or actin-based polymerization devices, respectively, as well as distinct Rab GTPases functioning along the two distinct steps of membrane traffic. Although several proteins identified in our screens contain domains that could molecularly connect coat assembly, cytoskeleton assembly and Rab-dependent membrane fusion, a future challenge will be to establish in terms of protein–protein interactions how these different protein networks are connected and how they precisely function in transport intermediate formation.
AP-3 Functions on Early Sorting Endosomes
Our analysis showing that PI-3P and the PI-3 kinase IIIC3 modulate AP-3 binding and LAMP-1 targeting indicates that AP-3 functions most efficiently in sorting on early sorting endosomes. This interpretation would agree with other morphological studies showing that AP-3 localizes to early endosomal exit sites together with LAMP-1 (Peden et al., 2004
). The high affinity of AP-3 for specific cargoes would therefore prevent their access to the cell surface and permit their selective, intracellular transport to lysosomes where they reside. Disturbing early endosome homeostasis would result in their missorting to the cell surface and most likely perturb the recycling of other endocytosed cargoes recycling back to the TGN, such as MPRs, as also observed in wortmannin-treated cells (Kundra and Kornfeld, 1998
). That AP-3 could contribute to stabilize Rab7 on membranes is interesting because this Rab GTPase controls protein transport from early to late endosomes (Press et al., 1998
), a maturation process in which Rab5-rich membrane domains are converted into Rab7-rich membrane domains (Rink et al., 2005
). In this regard, some proteins identified in our proteomic screen, such as the TBC1 domain family member 10 containing a Rab GAP domain, could potentially regulate this transition.
Borg4, Septins, and AP-3–dependent Protein Sorting
A surprising finding is the implication of Borg4 in AP-3–dependent lysosomal targeting. Borgs control septin organization, and they are negatively regulated by Cdc42 (Joberty et al., 2001
). Interestingly, several septin (SEPT) family members, in particular septin11 and septin7, which form complexes, were identified in our proteomic screen. Septins are GTP-binding proteins involved in various cellular processes, including cytoskeleton organization, cytokinesis, and diffusion of molecules between different cellular domains (Barral et al., 2000
; Kinoshita, 2006
; Spiliotis and Nelson, 2006
). In mammalian cells, septins regulate actin organization (Kremer at al., 2007
) and also bind to microtubules (Surka et al., 2002
; Nagata et al., 2003
; Spiliotis et al., 2005
), Very recently, tubulin-associated septin2 was shown to facilitate vesicle transport from the Golgi to the plasma membrane by maintaining polyglutamylated microtubule tracks and impeding tubulin binding of microtubule-associated protein 4, a regulatory step required for polarized, columnar-shaped epithelia biogenesis (Spiliotis et al., 2008
). This process could potentially involve IQGAP1, a Cdc42 target, which associates with septin2–exocyst complexes and regulates insulin secretion by pancreatic β cells (Rittmeyer et al., 2008
). How Borg4 and septins control AP-3–dependent targeting remains unknown. Protein transport from early to late endosomes includes several critical steps of protein sorting. During multivesicular body formation for example, ubiquitinated transmembrane proteins destined for degradation must be segregated away from other transmembrane proteins, such as LAMPs or LIMPs, which remain in the outer membrane. Alternately, cargo transport form early to late endosomes is facilitated by cytoskeleton elements, in particular, microtubules (Aniento et al., 1993
). If our study highlights the functional importance of Borg4, and probably specific septins in AP-3–dependent transport, additional studies will be needed to elucidate their precise function in coordinating membrane traffic with cytoskeleton organization.
| ACKNOWLEDGMENTS |
|---|
| Footnotes |
|---|
These authors contributed equally to this work. ![]()
Address correspondence to: Bernard Hoflack (bernard.hoflack{at}biotec.tu-dresden.de)
| REFERENCES |
|---|
|
|
|---|
Barral, Y., Mermall, V., Mooseker, M. S., and Snyder, M. (2000). Compartmentalization of the cell cortex by septins is required for maintenance of cell polarity in yeast. Mol. Cell 5, 841–851.[CrossRef][Medline]
Baust, T., Czupalla, C., Krause, E., Bourel-Bonnet, L., and Hoflack, B. (2006). Proteomic analysis of adaptor protein 1A coats selectively assembled on liposomes. Proc. Natl. Acad. Sci. USA 103, 3159–3164.
Bonifacino, J. S., and Glick, B. S. (2004). The mechanisms of vesicle budding and fusion. Cell 116, 153–166.[CrossRef][Medline]
Bonifacino, J. S., and Traub, L. M. (2003). Signals for sorting of transmembrane proteins to endosomes and lysosomes. Annu. Rev. Biochem 72, 395–447.[CrossRef][Medline]
Czupalla, C., Mansukoski, H., Pursche, T., Krause, E., and Hoflack, B. (2005). Comparative study of protein and mRNA expression during osteoclastogenesis. Proteomics 5, 3868–3875.[CrossRef][Medline]
D'Souza-Schorey, C., and Chavrier, P. (2006). ARF proteins: roles in membrane traffic and beyond. Nat. Rev. Mol. Cell Biol 7, 347–358.[CrossRef][Medline]
De Matteis, M. A., and Godi, A. (2004). PI-loting membrane traffic. Nat. Cell Biol 6, 487–492.[CrossRef][Medline]
Dell'Angelica, E. C., Ohno, H., Ooi, C. E., Rabinovich, E., Roche, K. W., and Bonifacino, J. S. (1997). AP-3, an adaptor-like protein complex with ubiquitous expression. EMBO J 16, 917–928.[CrossRef][Medline]
Dell'Angelica, E. C., Shotelersuk, V., Aguilar, R. C., Gahl, W. A., and Bonifacino, J. S. (1999). Altered trafficking of lysosomal proteins in Hermansky-Pudlak syndrome due to mutations in the beta 3A subunit of the AP-3 adaptor. Mol. Cell 3, 11–21.[CrossRef][Medline]
Di Fiore, P. P., Polo, S., and Hofmann, K. (2003). When ubiquitin meets ubiquitin receptors: a signalling connection. Nat. Rev. Mol. Cell Biol 4, 491–497.[CrossRef][Medline]
Di Paolo, G., and De Camilli, P. (2006). Phosphoinositides in cell regulation and membrane dynamics. Nature 443, 651–657.[CrossRef][Medline]
Donaldson, J. G., Kahn, R. A., Lippincott-Schwartz, J., and Klausner, R. D. (1991). Binding of ARF and beta-COP to Golgi membranes: possible regulation by a trimeric G protein. Science 254, 1197–1199.
Drake, M. T., Zhu, Y., and Kornfeld, S. (2000). The assembly of AP-3 adaptor complex-containing clathrin-coated vesicles on synthetic liposomes. Mol. Biol. Cell 11, 3723–3736.
Duncan, J. R., and Kornfeld, S. (1988). Intracellular movement of two mannose 6-phosphate receptors: return to the Golgi apparatus. J. Cell Biol 106, 617–628.
Feng, L. et al. (1999). The beta3A subunit gene (Ap3b1) of the AP-3 adaptor complex is altered in the mouse hypopigmentation mutant pearl, a model for Hermansky-Pudlak syndrome and night blindness. Hum. Mol. Genet 8, 323–330.
Harter, C., and Mellman, I. (1992). Transport of the lysosomal membrane glycoprotein lgp120 (lgp-A) to lysosomes does not require appearance on the plasma membrane. J. Cell Biol 117, 311–325.
Haucke, V., Wenk, M. R., Chapman, E. R., Farsad, K., and De Camilli, P. (2000). Dual interaction of synaptotagmin with mu2- and alpha-adaptin facilitates clathrin-coated pit nucleation. EMBO J 19, 6011–6019.[CrossRef][Medline]
Heldwein, E. E., Macia, E., Wang, J., Yin, H. L., Kirchhausen, T., and Harrison, S. C. (2004). Crystal structure of the clathrin adaptor protein 1 core. Proc. Natl. Acad. Sci. USA 101, 14108–14113.
Honing, S., Ricotta, D., Krauss, M., Spate, K., Spolaore, B., Motley, A., Robinson, M., Robinson, C., Haucke, V., and Owen, D. J. (2005). Phosphatidylinositol-(4,5)-bisphosphate regulates sorting signal recognition by the clathrin-associated adaptor complex AP2. Mol. Cell 18, 519–531.[CrossRef][Medline]
Janvier, K., and Bonifacino, J. S. (2005). Role of the endocytic machinery in the sorting of lysosome-associated membrane proteins. Mol. Biol. Cell 16, 4231–4242.
Joberty, G., Perlungher, R. R., Sheffield, P. J., Kinoshita, M., Noda, M., Haystead, T., and Macara, I. G. (2001). Borg proteins control septin organization and are negatively regulated by Cdc42. Nat. Cell Biol 3, 861–866.[CrossRef][Medline]
Kinoshita, M. (2006). Diversity of septin scaffolds. Curr. Opin. Cell Biol 18, 54–60.[CrossRef][Medline]
Kremer, B. E., Adang, L. A., and Macara, I. G. (2007). Septins regulate actin organization and cell-cycle arrest through nuclear accumulation of NCK mediated by SOCS7. Cell 130, 837–850.[Medline]
Kundra, R., and Kornfeld, S. (1998). Wortmannin retards the movement of the mannose 6-phosphate/insulin-like growth factor II receptor and its ligand out of endosomes. J. Biol. Chem 273, 3848–3853.
Le Borgne, R., Alconada, A., Bauer, U., and Hoflack, B. (1998). The mammalian AP-3 adaptor-like complex mediates the intracellular transport of lysosomal membrane glycoproteins. J. Biol. Chem 273, 29451–29461.
Miura, K., Jacques, K. M., Stauffer, S., Kubosaki, A., Zhu, K., Hirsch, D. S., Resau, J., Zheng, Y., and Randazzo, P. A. (2002). ARAP 1, a point of convergence for Arf and Rho signaling. Mol. Cell 9, 109–119.[CrossRef][Medline]
Munro, S. (2005). The Golgi apparatus: defining the identity of Golgi membranes. Curr. Opin. Cell Biol 17, 395–401.[CrossRef][Medline]
Nagata, K. et al. (2003). Filament formation of MSF-A, a mammalian septin, in human mammary epithelial cells depends on interactions with microtubules. J. Biol. Chem 278, 18538–18543.
Nie, Z., Boehm, M., Boja, E. S., Vass, W. C., Bonifacino, J. S., Fales, H. M., and Randazzo, P. A. (2003). Specific regulation of the adaptor protein complex AP-3 by the Arf GAP AGAP1. Dev. Cell 5, 513–521.[CrossRef][Medline]
Ooi, C. E., Dell'Angelica, E. C., and Bonifacino, J. S. (1998). ADP-Ribosylation factor 1 (ARF1) regulates recruitment of the AP-3 adaptor complex to membranes. J. Cell Biol 142, 391–402.
Owen, D. J., Collins, B. M., and Evans, P. R. (2004). Adaptors for clathrin coats: structure and function. Annu. Rev. Cell Dev. Biol 20, 153–191.[CrossRef][Medline]
Pal, A., Severin, F., Lommer, B., Shevchenko, A., and Zerial, M. (2006). Huntingtin-HAP40 complex is a novel Rab5 effector that regulates early endosome motility and is up-regulated in Huntington's disease. J. Cell Biol 172, 605–618.
Peden, A. A., Oorschot, V., Hesser, B. A., Austin, C. D., Scheller, R. H., and Klumperman, J. (2004). Localization of the AP-3 adaptor complex defines a novel endosomal exit site for lysosomal membrane proteins. J. Cell Biol 164, 1065–1076.
Press, B., Feng, Y., Hoflack, B., and Wandinger-Ness, A. (1998). Mutant Rab7 causes the accumulation of cathepsin D and cation-independent mannose 6-phosphate receptor in an early endocytic compartment. J. Cell Biol 140, 1075–1089.
Rink, J., Ghigo, E., Kalaidzidis, Y., and Zerial, M. (2005). Rab conversion as a mechanism of progression from early to late endosomes. Cell 122, 735–749.[CrossRef][Medline]
Rittmeyer, E. N., Daniel, S., Hsu, S. C., and Osman, M. A. (2008). A dual role for IQGAP1 in regulating exocytosis. J. Cell Sci 121, 391–403.
Robinson, M. S. (2004). Adaptable adaptors for coated vesicles. Trends Cell Biol 14, 167–174.[CrossRef][Medline]
Shen, X., Xu, K. F., Fan, Q., Pacheco-Rodriguez, G., Moss, J., and Vaughan, M. (2006). Association of brefeldin A-inhibited guanine nucleotide-exchange protein 2 (BIG2) with recycling endosomes during transferrin uptake. Proc. Natl. Acad. Sci. USA 103, 2635–2640.
Shin, H. W. et al. (2005). An enzymatic cascade of Rab5 effectors regulates phosphoinositide turnover in the endocytic pathway. J. Cell Biol 170, 607–618.
Simpson, F., Peden, A. A., Christopoulou, L., and Robinson, M. S. (1997). Characterization of the adaptor-related protein complex, AP-3. J. Cell Biol 137, 835–845.
Sirokmany, G., Szidonya, L., Kaldi, K., Gaborik, Z., Ligeti, E., and Geiszt, M. (2006). Sec14 homology domain targets p50RhoGAP to endosomes and provides a link between Rab and Rho GTPases. J. Biol. Chem 281, 6096–6105.
Spiliotis, E. T., Kinoshita, M., and Nelson, W. J. (2005). A mitotic septin scaffold required for Mammalian chromosome congression and segregation. Science 307, 1781–1785.
Spiliotis, E. T., and Nelson, W. J. (2006). Here come the septins: novel polymers that coordinate intracellular functions and organization. J. Cell Sci 119, 4–10.
Spiliotis, E. T., Hunt, S. J., Hu, Q., Kinoshita, M., and Nelson, W. J. (2008). Epithelial polarity requires septin coupling of vesicle transport to polyglutamylated microtubules. J. Cell Biol 180, 295–303.
Stinton, L. M., Selak, S., and Fritzler, M. J. (2005). Identification of GRASP-1 as a novel 97 kDa autoantigen localized to endosomes. Clin. Immunol 116, 108–117.[CrossRef][Medline]
Surka, M. C., Tsang, C. W., and Trimble, W. S. (2002). The mammalian septin MSF localizes with microtubules and is required for completion of cytokinesis. Mol. Biol. Cell 13, 3532–3545.
Waguri, S., Dewitte, F., Le Borgne, R., Rouille, Y., Uchiyama, Y., Dubremetz, J. F., and Hoflack, B. (2003). Visualization of TGN to endosome trafficking through fluorescently labeled MPR and AP-1 in living cells. Mol. Biol. Cell 14, 142–155.
Wang, Y. J., Wang, J., Sun, H. Q., Martinez, M., Sun, Y. X., Macia, E., Kirchhausen, T., Albanesi, J. P., Roth, M. G., and Yin, H. L. (2003). Phosphatidylinositol 4 phosphate regulates targeting of clathrin adaptor AP-1 complexes to the Golgi. Cell 114, 299–310.[CrossRef][Medline]
Zerial, M., and McBride, H. (2001). Rab proteins as membrane organizers. Nat. Rev. Mol. Cell Biol 2, 107–117.[CrossRef][Medline]
Zhu, Y., Drake, M. T., and Kornfeld, S. (1999). ADP-ribosylation factor 1 dependent clathrin-coat assembly on synthetic liposomes. Proc. Natl. Acad. Sci. USA 96, 5013–5018.
This article has been cited by other articles:
![]() |
G. Salazar, S. Zlatic, B. Craige, A. A. Peden, J. Pohl, and V. Faundez Hermansky-Pudlak Syndrome Protein Complexes Associate with Phosphatidylinositol 4-Kinase Type II {alpha} in Neuronal and Non-neuronal Cells J. Biol. Chem., January 16, 2009; 284(3): 1790 - 1802. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. B. Butterworth, R. S. Edinger, R. A. Frizzell, and J. P. Johnson Regulation of the epithelial sodium channel by membrane trafficking Am J Physiol Renal Physiol, January 1, 2009; 296(1): F10 - F24. [Abstract] [Full Text] [PDF] |
||||
![]() |
I. Hwang Sorting and Anterograde Trafficking at the Golgi Apparatus Plant Physiology, October 1, 2008; 148(2): 673 - 683. [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||